• Gene id: 55501

Gene Summary

• Gene Symbol: CHST12   Gene   UCSC   Ensembl
• Aliases: C4S-2, C4ST-2, C4ST2
• Gene name: carbohydrate sulfotransferase 12
• Alternate names: carbohydrate sulfotransferase 12, carbohydrate (chondroitin 4) sulfotransferase 12, chondroitin 4-O-sulfotransferase 2, chondroitin 4-sulfotransferase 2, sulfotransferase Hlo,
• Gene location: 7p22.3 (2403488: 2448483)     Exons: 8     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene belongs to the sulfotransferase 2 family. It is localized to the golgi membrane, and catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin and desulfated dermatan sulf
• OMIM: 610129

Protein Summary

• Protein general information: Q9NRB3  
  • Name: Carbohydrate sulfotransferase 12 (EC 2.8.2.5) (Chondroitin 4 O sulfotransferase 2) (Chondroitin 4 sulfotransferase 2) (C4ST 2) (C4ST2) (Sulfotransferase Hlo)
  • Length: 414  
  • Mass: 48414
  • Tissue specificity: Widely expressed. Expressed a high level in spinal chord, heart, spleen, thyroid, pituitary gland, adrenal gland, peripheral blood leukocytes, thymus, lung, small intestine, fetal kidney, fetal spleen and fetal lung. {ECO
• Sequence:

  MTKARLFRLWLVLGSVFMILLIIVYWDSAGAAHFYLHTSFSRPHTGPPLPTPGPDRDRELTADSDVDEFLDKFLS
  AGVKQSDLPRKETEQPPAPGSMEESVRGYDWSPRDARRSPDQGRQQAERRSVLRGFCANSSLAFPTKERAFDDIP
  NSELSHLIVDDRHGAIYCYVPKVACTNWKRVMIVLSGSLLHRGAPYRDPLRIPREHVHNASAHLTFNKFWRRYGK
  LSRHLMKVKLKKYTKFLFVRDPFVRLISAFRSKFELENEEFYRKFAVPMLRLYANHTSLPASAREAFRAGLKVSF
  ANFIQYLLDPHTEKLAPFNEHWRQVYRLCHPCQIDYDFVGKLETLDEDAAQLLQLLQVDRQLRFPPSYRNRTASS
  WEEDWFAKIPLAWRQQLYKLYEADFVLFGYPKPENLLRD

• Structural information:
  • Interpro: IPR018011  IPR005331  
  • STRING: ENSP00000481912
• Other Databases: GeneCards:  CHST12  Malacards:  CHST12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030166	proteoglycan biosynthetic process	IBA	biological process
GO:0008146	sulfotransferase activity	IBA	molecular function
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016051	carbohydrate biosynthetic process	IEA	biological process
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0047756	chondroitin 4-sulfotransferase activity	IEA	molecular function
GO:0030206	chondroitin sulfate biosynthetic process	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0047756	chondroitin 4-sulfotransferase activity	IDA	molecular function
GO:0030208	dermatan sulfate biosynthetic process	IDA	biological process
GO:0030206	chondroitin sulfate biosynthetic process	IDA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0050656	3'-phosphoadenosine 5'-phosphosulfate binding	NAS	molecular function
GO:0030173	integral component of Golgi membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00532	Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq