• Gene id: 5547

Gene Summary

• Gene Symbol: PRCP   Gene   UCSC   Ensembl
• Aliases: HUMPCP, PCP
• Gene name: prolylcarboxypeptidase
• Alternate names: lysosomal Pro-X carboxypeptidase, angiotensinase C, lysosomal carboxypeptidase C, proline carboxypeptidase,
• Gene location: 11q14.1 (52569445: 52547044)     Exons: 7     NC_000015.10
• Gene summary(Entrez): This gene encodes a member of the peptidase S28 family of serine exopeptidases. The encoded preproprotein is proteolytically processed to generate the mature lysosomal prolylcarboxypeptidase. This enzyme cleaves C-terminal amino acids linked to proline in
• OMIM: 176785

Protein Summary

• Protein general information: P42785  
  • Name: Lysosomal Pro X carboxypeptidase (EC 3.4.16.2) (Angiotensinase C) (Lysosomal carboxypeptidase C) (Proline carboxypeptidase) (Prolylcarboxypeptidase) (PRCP)
  • Length: 496  
  • Mass: 55800
  • Tissue specificity: Highest levels in placenta, lung and liver. Also present in heart, brain, pancreas and kidney.
• Sequence:

  MGRRALLLLLLSFLAPWATIALRPALRALGSLHLPTNPTSLPAVAKNYSVLYFQQKVDHFGFNTVKTFNQRYLVA
  DKYWKKNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFAEHRYYGESLPFGDNSFKDSRHLNFLTSEQA
  LADFAELIKHLKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKIVTTD
  FRKSGPHCSESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWISETWVNLAMVDYPYASNFLQP
  LPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNISETATSSLGTLGWSYQACTEVVMPFCTNG
  VDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGKNISSHTNIVFSNGELDPWSGGGVTKDITDTLVAVTI
  SEGAHHLDLRTKNALDPMSVLLARSLEVRHMKNWIRDFYDSAGKQH

• Structural information:
  • Interpro: IPR029058  IPR008758  IPR042269  
  • PDB: 3N2Z
  • PDBsum: 3N2Z
  • STRING: ENSP00000377055
• Other Databases: GeneCards:  PRCP  Malacards:  PRCP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008239	dipeptidyl-peptidase activity	IBA	molecular function
GO:0006508	proteolysis	IBA	biological process
GO:0003085	negative regulation of systemic arterial blood pressure	IBA	biological process
GO:0060055	angiogenesis involved in wound healing	IBA	biological process
GO:0043535	regulation of blood vessel endothelial cell migration	IBA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0004185	serine-type carboxypeptidase activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007597	blood coagulation, intrinsic pathway	TAS	biological process
GO:0035577	azurophil granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0002353	plasma kallikrein-kinin cascade	IEA	biological process
GO:0003085	negative regulation of systemic arterial blood pressure	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0042593	glucose homeostasis	IEA	biological process
GO:0045178	basal part of cell	IEA	cellular component
GO:0002155	regulation of thyroid hormone mediated signaling pathway	IEA	biological process
GO:0043535	regulation of blood vessel endothelial cell migration	IEA	biological process
GO:0060055	angiogenesis involved in wound healing	IEA	biological process
GO:0097009	energy homeostasis	IEA	biological process
GO:2000377	regulation of reactive oxygen species metabolic process	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04974	Protein digestion and absorption
hsa04614	Renin-angiotensin system

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)