• Gene id: 55466

Gene Summary

• Gene Symbol: DNAJA4   Gene   UCSC   Ensembl
• Aliases: MST104, MSTP104, PRO1472
• Gene name: DnaJ heat shock protein family (Hsp40) member A4
• Alternate names: dnaJ homolog subfamily A member 4, DnaJ (Hsp40) homolog, subfamily A, member 4,
• Gene location: 15q25.1 (29195450: 28994635)     Exons: 25     NC_000007.14

Protein Summary

• Protein general information: Q8WW22  
  • Name: DnaJ homolog subfamily A member 4
  • Length: 397  
  • Mass: 44798
• Sequence:

  MVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEGEKFKLISQAYEVLSDPKKRDVYDQGGEQAIKEG
  GSGSPSFSSPMDIFDMFFGGGGRMARERRGKNVVHQLSVTLEDLYNGVTKKLALQKNVICEKCEGVGGKKGSVEK
  CPLCKGRGMQIHIQQIGPGMVQQIQTVCIECKGQGERINPKDRCESCSGAKVIREKKIIEVHVEKGMKDGQKILF
  HGEGDQEPELEPGDVIIVLDQKDHSVFQRRGHDLIMKMKIQLSEALCGFKKTIKTLDNRILVITSKAGEVIKHGD
  LRCVRDEGMPIYKAPLEKGILIIQFLVIFPEKHWLSLEKLPQLEALLPPRQKVRITDDMDQVELKEFCPNEQNWR
  QHREAYEEDEDGPQAGVQCQTA

• Structural information:
  • Protein Domains: (4..7-)
    (/note="J"-)
  • Interpro: IPR012724  IPR002939  IPR001623  IPR018253  IPR008971   IPR001305  IPR036410  IPR036869  
  • Prosite: PS00636 PS50076 PS51188
  • CDD: cd06257 cd10719
  • STRING: ENSP00000378324
• Other Databases: GeneCards:  DNAJA4  Malacards:  DNAJA4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0010596	negative regulation of endothelial cell migration	IMP	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0006457	protein folding	IEA	biological process
GO:0009408	response to heat	IEA	biological process
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0031072	heat shock protein binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0042026	protein refolding	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0090084	negative regulation of inclusion body assembly	IDA	biological process
GO:0051082	unfolded protein binding	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0051087	chaperone binding	IPI	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0051087	chaperone binding	IPI	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray