• Gene id: 55437

Gene Summary

• Gene Symbol: STRADB   Gene   UCSC   Ensembl
• Aliases: ALS2CR2, CALS-21, ILPIP, ILPIPA, PAPK, PRO1038
• Gene name: STE20 related adaptor beta
• Alternate names: STE20-related kinase adapter protein beta, ILP-interacting protein ILPIPA, STE20-related kinase adaptor beta, STRAD beta, amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 2, amyotrophic lateral sclerosis 2 chromosomal region candidate ge,
• Gene location: 2q33.1 (201451733: 201480845)     Exons: 12     NC_000002.12
• Gene summary(Entrez): This gene encodes a protein that belongs to the serine/threonine protein kinase STE20 subfamily. One of the active site residues in the protein kinase domain of this protein is altered, and it is thus a pseudokinase. This protein is a component of a compl
• OMIM: 607333

Protein Summary

• Protein general information: Q9C0K7  
  • Name: STE20 related kinase adapter protein beta (STRAD beta) (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 2 protein) (CALS 21) (ILP interacting protein) (Pseudokinase ALS2CR2)
  • Length: 418  
  • Mass: 47026
  • Tissue specificity: Highly expressed in heart, skeletal muscle, testis, liver and colon. {ECO
• Sequence:

  MSLLDCFCTSRTQVESLRPEKQSETSIHQYLVDEPTLSWSRPSTRASEVLCSTNVSHYELQVEIGRGFDNLTSVH
  LARHTPTGTLVTIKITNLENCNEERLKALQKAVILSHFFRHPNITTYWTVFTVGSWLWVISPFMAYGSASQLLRT
  YFPEGMSETLIRNILFGAVRGLNYLHQNGCIHRSIKASHILISGDGLVTLSGLSHLHSLVKHGQRHRAVYDFPQF
  STSVQPWLSPELLRQDLHGYNVKSDIYSVGITACELASGQVPFQDMHRTQMLLQKLKGPPYSPLDISIFPQSESR
  MKNSQSGVDSGIGESVLVSSGTHTVNSDRLHTPSSKTFSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEE
  SQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDEKDSYWEF

• Structural information:
  • Protein Domains: (58..36-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  
  • Prosite: PS50011
  • STRING: ENSP00000194530
• Other Databases: GeneCards:  STRADB  Malacards:  STRADB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0023014	signal transduction by protein phosphorylation	IBA	biological process
GO:0031098	stress-activated protein kinase signaling cascade	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0007346	regulation of mitotic cell cycle	IBA	biological process
GO:0032147	activation of protein kinase activity	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007050	cell cycle arrest	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000902	cell morphogenesis	IEA	biological process
GO:2001240	negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016235	aggresome	IDA	cellular component
GO:0006611	protein export from nucleus	IDA	biological process
GO:0032147	activation of protein kinase activity	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	NOT|biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0004672	protein kinase activity	IDA	NOT|molecular function

KEGG pathways

Pathway id	Pathway name
hsa04150	mTOR signaling pathway
hsa04152	AMPK signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male factor infertility	MIK: 29961538
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray