• Gene id: 55423

Gene Summary

• Gene Symbol: SIRPG   Gene   UCSC   Ensembl
• Aliases: CD172g, SIRP-B2, SIRPB2, SIRPgamma, bA77C3.1
• Gene name: signal regulatory protein gamma
• Alternate names: signal-regulatory protein gamma, CD172 antigen-like family member B, CD172g antigen, SIRP beta 2, SIRP-gamma, signal-regulatory protein beta-2,
• Gene location: 20p13 (1686515: 1629151)     Exons: 8     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the signal-regulatory protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulat
• OMIM: 605466

SNPs

rs1048055

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000020.11   g.1629416A>C
NC_000020.10   g.1610062A>C
NM_018556.4   c.*223T>G
NM_018556.3   c.*223T>G
XM_005260749.4   c.*223T>G
XM_005260749.1   c.*223T>G
XM_011529286.2   c.*223T>G
NM_080816.2   c.*223T>G
NM_080816.3   c.*223T>G
NM_001039508.1   c.*223T>G|SEQ=[A/C]|

rs2281807

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000020.11   g.1629555C>T
NC_000020.10   g.1610201C>T
NM_018556.4   c.*84G>A
NM_018556.3   c.*84G>A
XM_005260749.4   c.*84G>A
XM_005260749.1   c.*84G>A
XM_011529286.2   c.*84G>A
NM_080816.2   c.*84G>A
NM_080816.3   c.*84G>A
NM_001039508.1   c.*84G>A|SEQ=[C/T]|GENE=SIR

Protein Summary

• Protein general information: Q9P1W8  
  • Name: Signal regulatory protein gamma (SIRP gamma) (CD172 antigen like family member B) (Signal regulatory protein beta 2) (SIRP b2) (SIRP beta 2) (CD antigen CD172g)
  • Length: 387  
  • Mass: 42,498
• Sequence:

  MPVPASWPHPPGPFLLLTLLLGLTEVAGEEELQMIQPEKLLLVTVGKTATLHCTVTSLLPVGPVLWFRGVGPGRE
  LIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGAKPSAPV
  VLGPAARTTPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPTGQSVAYSIRSTARVVLDPWDVRSQVI
  CEVAHVTLQGDPLRGTANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQVRKFYPQSLQLTWSENGNVCQRETASTL
  TENKDGTYNWTSWFLVNISDQRDDVVLTCQVKHDGQLAVSKRLALEVTVHQKDQSSDATPGPASSLTALLLIAVL
  LGPIYVPWKQKT

• Structural information:
  • Protein Domains: Ig-like (29-137)
    Ig-like (146-245)
    Ig-like (252-340)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003597  IPR003599   IPR013106  
  • Prosite: PS50835
  • PDB: 2JJW 4I2X
  • PDBsum: 2JJW 4I2X
  • STRING: ENSP00000305529
• Other Databases: GeneCards:  SIRPG  Malacards:  SIRPG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005622	intracellular	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008285	negative regulation of cell proliferation	TAS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0022409	positive regulation of cell-cell adhesion	IDA	biological process
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0050870	positive regulation of T cell activation	IDA	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005622	intracellular	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008285	negative regulation of cell proliferation	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0022409	positive regulation of cell-cell adhesion	IDA	biological process
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0050870	positive regulation of T cell activation	IDA	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008285	negative regulation of cell proliferation	TAS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0022409	positive regulation of cell-cell adhesion	IDA	biological process
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0050870	positive regulation of T cell activation	IDA	biological process
GO:0050900	leukocyte migration	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04380	Osteoclast differentiation

Diseases

Associated diseases	References
Diabetes	GAD: 19430480
Spermatogenesis defects	MIK: 24303009
Non obstructive azoospermia	MIK: 24162948
Oligozoospermia	MIK: 24303009
Azoospermia	MIK: 24303009
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Non-obstructive azoospermia (NOA)	MIK: 24162948
Spermatogenic defects	MIK: 31037746
Azoospermia	MIK: 24303009
Oligozoospermia	MIK: 24303009
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24162948	Non-obstructive azoospermia (NOA)	SIRPG (rs1048055, rs2281807), SOX5 (rs11046992, rs146039840, SIRPA (chr20. 1902132, chr20. 1902301))		1198 (618 patients with non-obstructive azoospermia (NOA), 580 healthy controls)	Male infertility	SIRPG SIRPA SOX5
24303009	Spermatogenic impairment, azoospermia, oligozoospermia	rs3791185 and rs2232015 in PRMT6, rs146039840 and rs11046992 in Sox5, rs1129332 in PEX10, rs3197744 in SIRPA, rs1048055 in SIRPG		1376 (784 individuals with oligozoospermia, 592 healthy controls)	Male infertility
29713536	Sperm number defects	c.*223?T?>?G (3?UTR)			Male infertility	NGS
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray