• Gene id: 55421

Gene Summary

• Gene Symbol: NCBP3   Gene   UCSC   Ensembl
• Aliases: C17orf85, ELG, HSA277841
• Gene name: nuclear cap binding subunit 3
• Alternate names: nuclear cap-binding protein subunit 3, CTD-3195I5.1, CTD-3195I5.5,
• Gene location: 17p13.2 (3846245: 3802157)     Exons: 15     NC_000017.11
• OMIM: 616624

Protein Summary

• Protein general information: Q53F19  
  • Name: Nuclear cap binding protein subunit 3 (Protein ELG)
  • Length: 620  
  • Mass: 70593
• Sequence:

  MAAVRGLRVSVKAEAPAGPALGLPSPEAESGVDRGEPEPMEVEEGELEIVPVRRSLKELIPDTSRRYENKAGSFI
  TGIDVTSKEAIEKKEQRAKRFHFRSEVNLAQRNVALDRDMMKKAIPKVRLETIYICGVDEMSTQDVFSYFKEYPP
  AHIEWLDDTSCNVVWLDEMTATRALINMSSLPAQDKIRSRDASEDKSAEKRKKDKQEDSSDDDEAEEGEVEDENS
  SDVELDTLSQVEEESLLRNDLRPANKLAKGNRLFMRFATKDDKKELGAARRSQYYMKYGNPNYGGMKGILSNSWK
  RRYHSRRIQRDVIKKRALIGDDVGLTSYKHRHSGLVNVPEEPIEEEEEEEEEEEEEEEEDQDMDADDRVVVEYHE
  ELPALKQPRERSASRRSSASSSDSDEMDYDLELKMISTPSPKKSMKMTMYADEVESQLKNIRNSMRADSVSSSNI
  KNRIGNKLPPEKFADVRHLLDEKRQHSRPRPPVSSTKSDIRQRLGKRPHSPEKAFSSNPVVRREPSSDVHSRLGV
  PRQDSKGLYADTREKKSGNLWTRLGSAPKTKEKNTKKVDHRAPGAEEDDSELQRAWGALIKEKEQSRQKKSRLDN
  LPSLQIEVSRESSSGSEAES

• Structural information:
  • Interpro: IPR019416  IPR012677  
  • STRING: ENSP00000373657
• Other Databases: GeneCards:  NCBP3  Malacards:  NCBP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000339	RNA cap binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003729	mRNA binding	IBA	molecular function
GO:0003729	mRNA binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0051607	defense response to virus	IMP	biological process
GO:0000340	RNA 7-methylguanosine cap binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034518	RNA cap binding complex	TAS	cellular component
GO:0000340	RNA 7-methylguanosine cap binding	IEA	molecular function
GO:0003729	mRNA binding	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0051028	mRNA transport	IEA	biological process
GO:0006370	7-methylguanosine mRNA capping	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000339	RNA cap binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq