• Gene id: 55367

Gene Summary

• Gene Symbol: PIDD1   Gene   UCSC   Ensembl
• Aliases: LRDD, PIDD
• Gene name: p53-induced death domain protein 1
• Alternate names: p53-induced death domain-containing protein 1, leucine-rich repeat and death domain-containing protein, leucine-rich repeats and death domain containing, p53-induced protein with a death domain,
• Gene location: 11p15.5 (809866: 799178)     Exons: 18     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene contains a leucine-rich repeat and a death domain. This protein has been shown to interact with other death domain proteins, such as Fas (TNFRSF6)-associated via death domain (FADD) and MAP-kinase activating death domain-c
• OMIM: 602470

Protein Summary

• Protein general information: Q9HB75  
  • Name: p53 induced death domain containing protein 1 (EC 3.4.21. ) (Leucine rich repeat and death domain containing protein) [Cleaved into: PIDD N; PIDD C; PIDD CC]
  • Length: 910  
  • Mass: 99712
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MAATVEGPELEAAAAAGDASEDSDAGSRALPFLGGNRLSLDLYPGGCQQLLHLCVQQPLQLLQVEFLRLSTHEDP
  QLLEATLAQLPQSLSCLRSLVLKGGQRRDTLGACLRGALTNLPAGLSGLAHLAHLDLSFNSLETLPACVLQMRGL
  GALLLSHNCLSELPEALGALPALTFLTVTHNRLQTLPPALGALSTLQRLDLSQNLLDTLPPEIGGLGSLLELNLA
  SNRLQSLPASLAGLRSLRLLVLHSNLLASVPADLARLPLLTRLDLRDNQLRDLPPELLDAPFVRLQGNPLGEASP
  DAPSSPVAALIPEMPRLFLTSDLDSFPVTPQGCSVTLACGVRLQFPAGATATPITIRYRLLLPEPGLVPLGPHDA
  LLSHVLELQPHGVAFQQDVGLWLLFTPPQARRCREVVVRTRNDNSWGDLETYLEEEAPQRLWAHCQVPHFSWFLV
  VSRPVSNACLVPPEGTLLCSSGHPGVKVIFPPGATEEPRRVSMQVVRMAGRELQALLGEPEAAVSPLLCLSQSGP
  PSFLQPVTVQLPLPSGITGLSLDRSRLHLLYWAPPAATWDDITAQVVLELTHLYARFQVTHFSWYWLWYTTKNCV
  GGLARKAWERLRLHRVNLIALQRRRDPEQVLLQCLPRNKVDATLRRLLERYRGPEPSDTVEMFEGEEFFAAFERG
  IDVDADRPDCVEGRICFVFYSHLKNVKEVYVTTTLDREAQAVRGQVSFYRGAVPVRVPEEAEAARQRKGADALWM
  ATLPIKLPRLRGSEGPRRGAGLSLAPLNLGDAETGFLTQSNLLSVAGRLGLDWPAVALHLGVSYREVQRIRHEFR
  DDLDEQIRHMLFSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIRRMGLAPKDPALPGSS
  APQPPEPAQA

• Structural information:
  • Protein Domains: (322..45-)
    (/note="ZU5-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00485-)
    (455..59-)
    (/note="ZU5-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00485-)
    (788..87-)
    (/note="Death-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00064"-)
  • Interpro: IPR011029  IPR000488  IPR001611  IPR003591  IPR032675   IPR019502  IPR000906  
  • Prosite: PS50017 PS51450 PS51145
  • PDB: 2OF5
  • PDBsum: 2OF5
  • STRING: ENSP00000337797
• Other Databases: GeneCards:  PIDD1  Malacards:  PIDD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IBA	biological process
GO:0007165	signal transduction	IBA	biological process
GO:0004175	endopeptidase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0016540	protein autoprocessing	IDA	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0004175	endopeptidase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0006915	apoptotic process	IMP	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005123	death receptor binding	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097190	apoptotic signaling pathway	IEA	biological process
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IEA	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0005737	cytoplasm	IMP	cellular component
GO:0051092	positive regulation of NF-kappaB transcription factor activity	TAS	biological process
GO:0043065	positive regulation of apoptotic process	TAS	biological process
GO:0005634	nucleus	IMP	cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04210	Apoptosis
hsa04064	NF-kappa B signaling pathway
hsa04115	p53 signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq