• Gene id: 55366

Gene Summary

• Gene Symbol: LGR4   Gene   UCSC   Ensembl
• Aliases: BNMD17, GPR48
• Gene name: leucine rich repeat containing G protein-coupled receptor 4
• Alternate names: leucine-rich repeat-containing G-protein coupled receptor 4, G protein-coupled receptor 48,
• Gene location: 11p14.1 (27472789: 27365960)     Exons: 18     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a G-protein coupled receptor that binds R-spondins and activates the Wnt signaling pathway. This Wnt signaling pathway activation is necessary for proper development of many organs of the body. [provided by RefSeq, Oct
• OMIM: 606666

Protein Summary

• Protein general information: Q9BXB1  
  • Name: Leucine rich repeat containing G protein coupled receptor 4 (G protein coupled receptor 48)
  • Length: 951  
  • Mass: 104475
  • Tissue specificity: Expressed in multiple steroidogenic tissues
• Sequence:

  MPGPLGLLCFLALGLLGSAGPSGAAPPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPED
  AFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFE
  GLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLD
  NLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHS
  LVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRN
  QIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDVSFNELTSFPTEGLNGLNQLKLVGNFKLKEA
  LAAKDFVNLRSLSVPYAYQCCAFWGCDSYANLNTEDNSLQDHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPS
  TGAFKPCEYLLGSWMIRLTVWFIFLVALFFNLLVILTTFASCTSLPSSKLFIGLISVSNLFMGIYTGILTFLDAV
  SWGRFAEFGIWWETGSGCKVAGFLAVFSSESAIFLLMLATVERSLSAKDIMKNGKSNHLKQFRVAALLAFLGATV
  AGCFPLFHRGEYSASPLCLPFPTGETPSLGFTVTLVLLNSLAFLLMAVIYTKLYCNLEKEDLSENSQSSMIKHVA
  WLIFTNCIFFCPVAFFSFAPLITAISISPEIMKSVTLIFFPLPACLNPVLYVFFNPKFKEDWKLLKRRVTKKSGS
  VSVSISSQGGCLEQDFYYDCGMYSHLQGNLTVCDCCESFLLTKPVSCKHLIKSHSCPALAVASCQRPEGYWSDCG
  TQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKD

• Structural information:
  • Protein Domains: (25..5-)
    (/note="LRRNT"-)
  • Interpro: IPR000276  IPR017452  IPR002131  IPR001611  IPR003591   IPR032675  IPR000372  
  • Prosite: PS50262 PS51450
  • PDB: 4KT1 4QXE 4QXF
  • PDBsum: 4KT1 4QXE 4QXF
  • DIP: 59894
  • STRING: ENSP00000368516
• Other Databases: GeneCards:  LGR4  Malacards:  LGR4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0009755	hormone-mediated signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007190	activation of adenylate cyclase activity	IBA	biological process
GO:0008528	G protein-coupled peptide receptor activity	IBA	molecular function
GO:0090263	positive regulation of canonical Wnt signaling pathway	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0004930	G protein-coupled receptor activity	IDA	NOT|molecular function
GO:0004888	transmembrane signaling receptor activity	IDA	molecular function
GO:0004888	transmembrane signaling receptor activity	IDA	molecular function
GO:0050710	negative regulation of cytokine secretion	ISS	biological process
GO:0007283	spermatogenesis	ISS	biological process
GO:0001649	osteoblast differentiation	ISS	biological process
GO:0032922	circadian regulation of gene expression	ISS	biological process
GO:0046849	bone remodeling	ISS	biological process
GO:0034122	negative regulation of toll-like receptor signaling pathway	ISS	biological process
GO:0030282	bone mineralization	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016500	protein-hormone receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0072224	metanephric glomerulus development	IEA	biological process
GO:0072202	cell differentiation involved in metanephros development	IEA	biological process
GO:0050710	negative regulation of cytokine secretion	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0035239	tube morphogenesis	IEA	biological process
GO:0030539	male genitalia development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0001942	hair follicle development	IEA	biological process
GO:0001649	osteoblast differentiation	IEA	biological process
GO:2001013	epithelial cell proliferation involved in renal tubule morphogenesis	IEA	biological process
GO:0120163	negative regulation of cold-induced thermogenesis	IEA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0090190	positive regulation of branching involved in ureteric bud morphogenesis	IEA	biological process
GO:0072282	metanephric nephron tubule morphogenesis	IEA	biological process
GO:0061290	canonical Wnt signaling pathway involved in metanephric kidney development	IEA	biological process
GO:0050673	epithelial cell proliferation	IEA	biological process
GO:0048565	digestive tract development	IEA	biological process
GO:0046849	bone remodeling	IEA	biological process
GO:0036335	intestinal stem cell homeostasis	IEA	biological process
GO:0034122	negative regulation of toll-like receptor signaling pathway	IEA	biological process
GO:0032922	circadian regulation of gene expression	IEA	biological process
GO:0030282	bone mineralization	IEA	biological process
GO:0007623	circadian rhythm	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0120163	negative regulation of cold-induced thermogenesis	ISS	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04310	Wnt signaling pathway

Diseases

Associated diseases	References
Osteoporosis	KEGG:H01593
Osteoporosis	KEGG:H01593
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)