• Gene id: 55365

Gene Summary

• Gene Symbol: TMEM176A   Gene   UCSC   Ensembl
• Aliases: GS188, HCA112, MS4B1
• Gene name: transmembrane protein 176A
• Alternate names: transmembrane protein 176A, hepatocellular carcinoma-associated antigen 112, likley ortholog of mouse GS188,
• Gene location: 7q36.1 (150800542: 150805118)     Exons: 7     NC_000007.14
• OMIM: 606551

Protein Summary

• Protein general information: Q96HP8  
  • Name: Transmembrane protein 176A (Hepatocellular carcinoma associated antigen 112)
  • Length: 235  
  • Mass: 26116
• Sequence:

  MGTADSDEMAPEAPQHTHIDVHIHQESALAKLLLTCCSALRPRATQARGSSRLLVASWVMQIVLGILSAVLGGFF
  YIRDYTLLVTSGAAIWTGAVAVLAGAAAFIYEKRGGTYWALLRTLLTLAAFSTAIAALKLWNEDFRYGYSYYNSA
  CRISSSSDWNTPAPTQSPEEVRRLHLCTSFMDMLKALFRTLQAMLLGVWILLLLASLTPLWLYCWRMFPTKGKRD
  QKEMLEVSGI

• Structural information:
  • Interpro: IPR007237  IPR009281  
  • STRING: ENSP00000417626
• Other Databases: GeneCards:  TMEM176A  Malacards:  TMEM176A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2001199	negative regulation of dendritic cell differentiation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R