• Gene id: 55364

Gene Summary

• Gene Symbol: IMPACT   Gene   UCSC   Ensembl
• Aliases: RWDD5
• Gene name: impact RWD domain protein
• Alternate names: protein IMPACT, Impact homolog, RWD domain containing 5, imprinted and ancient gene protein homolog,
• Gene location: 18q11.2 (24426669: 24453530)     Exons: 12     NC_000018.10

Protein Summary

• Protein general information: Q9P2X3  
  • Name: Protein IMPACT (Imprinted and ancient gene protein homolog)
  • Length: 320  
  • Mass: 36476
  • Tissue specificity: Widely expressed. Expressed at high level in brain. {ECO
• Sequence:

  MAEGDAGSDQRQNEEIEAMAAIYGEEWCVIDDCAKIFCIRISDDIDDPKWTLCLQVMLPNEYPGTAPPIYQLNAP
  WLKGQERADLSNSLEEIYIQNIGESILYLWVEKIRDVLIQKSQMTEPGPDVKKKTEEEDVECEDDLILACQPESS
  LKALDFDISETRTEVEVEELPPIDHGIPITDRRSTFQAHLAPVVCPKQVKMVLSKLYENKKIASATHNIYAYRIY
  CEDKQTFLQDCEDDGETAAGGRLLHLMEILNVKNVMVVVSRWYGGILLGPDRFKHINNCARNILVEKNYTNSPEE
  SSKALGKNKKVRKDKKRNEH

• Structural information:
  • Protein Domains: (14..11-)
    (/note="RWD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00179"-)
  • Interpro: IPR023582  IPR001498  IPR036956  IPR020568  IPR006575   IPR016135  IPR020569  
  • Prosite: PS50908 PS00910
  • STRING: ENSP00000284202
• Other Databases: GeneCards:  IMPACT  Malacards:  IMPACT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071264	positive regulation of translational initiation in response to starvation	IBA	biological process
GO:0060733	regulation of eIF2 alpha phosphorylation by amino acid starvation	IBA	biological process
GO:0043022	ribosome binding	IBA	molecular function
GO:0001933	negative regulation of protein phosphorylation	IBA	biological process
GO:1905538	polysome binding	IBA	molecular function
GO:0005844	polysome	IBA	cellular component
GO:0004860	protein kinase inhibitor activity	IBA	molecular function
GO:0071494	cellular response to UV-C	ISS	biological process
GO:0042149	cellular response to glucose starvation	ISS	biological process
GO:0031333	negative regulation of protein-containing complex assembly	ISS	biological process
GO:0072755	cellular response to benomyl	ISS	biological process
GO:0060548	negative regulation of cell death	ISS	biological process
GO:0034198	cellular response to amino acid starvation	ISS	biological process
GO:0097201	negative regulation of transcription from RNA polymerase II promoter in response to stress	ISS	biological process
GO:0071468	cellular response to acidic pH	ISS	biological process
GO:0070301	cellular response to hydrogen peroxide	ISS	biological process
GO:0071264	positive regulation of translational initiation in response to starvation	ISS	biological process
GO:0060733	regulation of eIF2 alpha phosphorylation by amino acid starvation	ISS	biological process
GO:0045666	positive regulation of neuron differentiation	ISS	biological process
GO:0031953	negative regulation of protein autophosphorylation	ISS	biological process
GO:0001933	negative regulation of protein phosphorylation	ISS	biological process
GO:0005844	polysome	ISS	cellular component
GO:1990253	cellular response to leucine starvation	ISS	biological process
GO:1990138	neuron projection extension	ISS	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	ISS	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0006417	regulation of translation	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0006446	regulation of translational initiation	IEA	biological process
GO:0031333	negative regulation of protein-containing complex assembly	IEA	biological process
GO:0031953	negative regulation of protein autophosphorylation	IEA	biological process
GO:0034198	cellular response to amino acid starvation	IEA	biological process
GO:0042149	cellular response to glucose starvation	IEA	biological process
GO:0043022	ribosome binding	IEA	molecular function
GO:0045666	positive regulation of neuron differentiation	IEA	biological process
GO:0060548	negative regulation of cell death	IEA	biological process
GO:0060733	regulation of eIF2 alpha phosphorylation by amino acid starvation	IEA	biological process
GO:0071264	positive regulation of translational initiation in response to starvation	IEA	biological process
GO:0071494	cellular response to UV-C	IEA	biological process
GO:0072755	cellular response to benomyl	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005844	polysome	IEA	cellular component
GO:0070301	cellular response to hydrogen peroxide	IEA	biological process
GO:0071468	cellular response to acidic pH	IEA	biological process
GO:0097201	negative regulation of transcription from RNA polymerase II promoter in response to stress	IEA	biological process
GO:1990138	neuron projection extension	IEA	biological process
GO:1990253	cellular response to leucine starvation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0008150	biological_process	ND	biological process
GO:0005575	cellular_component	ND	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881