• Gene id: 5536

Gene Summary

• Gene Symbol: PPP5C   Gene   UCSC   Ensembl
• Aliases: PP5, PPP5, PPT
• Gene name: protein phosphatase 5 catalytic subunit
• Alternate names: serine/threonine-protein phosphatase 5, PP-T, protein phosphatase T,
• Gene location: 19q13.32 (46347068: 46390974)     Exons: 12     NC_000019.10
• Gene summary(Entrez): This gene encodes a serine/threonine phosphatase which is a member of the protein phosphatase catalytic subunit family. Proteins in this family participate in pathways regulated by reversible phosphorylation at serine and threonine residues; many of these
• OMIM: 612163

Protein Summary

• Protein general information: P53041  
  • Name: Serine/threonine protein phosphatase 5 (PP5) (EC 3.1.3.16) (Protein phosphatase T) (PP T) (PPT)
  • Length: 499  
  • Mass: 56879
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRT
  ECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFER
  AIAGDEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLST
  LVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLL
  RGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQP
  PDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPN
  YCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYANTLLQLGMM

• Structural information:
  • Interpro: IPR004843  IPR029052  IPR041753  IPR013235  IPR006186   IPR011236  IPR013026  IPR011990  IPR001440  IPR019734  
  • Prosite: PS00125 PS50005 PS50293
  • CDD: cd07417
  • PDB: 1A17 1S95 1WAO 2BUG 3H60 3H61 3H62 3H63 3H64 3H66 3H67 3H68 3H69 4ZVZ 4ZX2 5HPE 5UI1 5WG8
  • PDBsum: 1A17 1S95 1WAO 2BUG 3H60 3H61 3H62 3H63 3H64 3H66 3H67 3H68 3H69 4ZVZ 4ZX2 5HPE 5UI1 5WG8
  • DIP: 29043
  • STRING: ENSP00000012443
• Other Databases: GeneCards:  PPP5C  Malacards:  PPP5C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016791	phosphatase activity	IDA	molecular function
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0048156	tau protein binding	NAS	molecular function
GO:0004722	protein serine/threonine phosphatase activity	ISS	molecular function
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:1904550	response to arachidonic acid	ISS	biological process
GO:0070262	peptidyl-serine dephosphorylation	TAS	biological process
GO:0010288	response to lead ion	ISS	biological process
GO:0035970	peptidyl-threonine dephosphorylation	TAS	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0004722	protein serine/threonine phosphatase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0070262	peptidyl-serine dephosphorylation	IDA	biological process
GO:0004722	protein serine/threonine phosphatase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0006351	transcription, DNA-templated	TAS	biological process
GO:0000278	mitotic cell cycle	TAS	biological process
GO:0006470	protein dephosphorylation	TAS	biological process
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0032991	protein-containing complex	IDA	cellular component
GO:0043531	ADP binding	IDA	molecular function
GO:0005524	ATP binding	IDA	molecular function
GO:0000165	MAPK cascade	TAS	biological process
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001965	G-protein alpha-subunit binding	IEA	molecular function
GO:0004722	protein serine/threonine phosphatase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016576	histone dephosphorylation	IEA	biological process
GO:0031072	heat shock protein binding	IEA	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0070301	cellular response to hydrogen peroxide	IEA	biological process
GO:0071276	cellular response to cadmium ion	IEA	biological process
GO:1904550	response to arachidonic acid	IEA	biological process
GO:1990635	proximal dendrite	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0010288	response to lead ion	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0060548	negative regulation of cell death	IEA	biological process
GO:0071944	cell periphery	IEA	cellular component
GO:1901215	negative regulation of neuron death	IEA	biological process
GO:2000324	positive regulation of glucocorticoid receptor signaling pathway	IEA	biological process
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0043278	response to morphine	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0051879	Hsp90 protein binding	IPI	molecular function
GO:0051879	Hsp90 protein binding	IPI	molecular function
GO:0101031	chaperone complex	IDA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	HMP	biological process
GO:0004721	phosphoprotein phosphatase activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016791	phosphatase activity	IDA	molecular function
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0048156	tau protein binding	NAS	molecular function
GO:0004722	protein serine/threonine phosphatase activity	ISS	molecular function
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:1904550	response to arachidonic acid	ISS	biological process
GO:0070262	peptidyl-serine dephosphorylation	TAS	biological process
GO:0010288	response to lead ion	ISS	biological process
GO:0035970	peptidyl-threonine dephosphorylation	TAS	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0004722	protein serine/threonine phosphatase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0070262	peptidyl-serine dephosphorylation	IDA	biological process
GO:0004722	protein serine/threonine phosphatase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0006351	transcription, DNA-templated	TAS	biological process
GO:0000278	mitotic cell cycle	TAS	biological process
GO:0006470	protein dephosphorylation	TAS	biological process
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0032991	protein-containing complex	IDA	cellular component
GO:0043531	ADP binding	IDA	molecular function
GO:0005524	ATP binding	IDA	molecular function
GO:0000165	MAPK cascade	TAS	biological process
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001965	G-protein alpha-subunit binding	IEA	molecular function
GO:0004722	protein serine/threonine phosphatase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016576	histone dephosphorylation	IEA	biological process
GO:0031072	heat shock protein binding	IEA	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0070301	cellular response to hydrogen peroxide	IEA	biological process
GO:0071276	cellular response to cadmium ion	IEA	biological process
GO:1904550	response to arachidonic acid	IEA	biological process
GO:1990635	proximal dendrite	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0010288	response to lead ion	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0060548	negative regulation of cell death	IEA	biological process
GO:0071944	cell periphery	IEA	cellular component
GO:1901215	negative regulation of neuron death	IEA	biological process
GO:2000324	positive regulation of glucocorticoid receptor signaling pathway	IEA	biological process
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0043278	response to morphine	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0051879	Hsp90 protein binding	IPI	molecular function
GO:0051879	Hsp90 protein binding	IPI	molecular function
GO:0101031	chaperone complex	IDA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	HMP	biological process
GO:0004721	phosphoprotein phosphatase activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq