• Gene id: 55356

Gene Summary

• Gene Symbol: SLC22A15   Gene   UCSC   Ensembl
• Aliases: FLIPT1, PRO34686
• Gene name: solute carrier family 22 member 15
• Alternate names: solute carrier family 22 member 15, flipt 1, fly-like putative organic ion transporter 1, fly-like putative transporter 1, solute carrier family 22 (organic cation transporter), member 15, trans-like protein,
• Gene location: 1p13.1 (56993873: 56957930)     Exons: 6     NC_000008.11
• Gene summary(Entrez): Organic ion transporters, such as SLC22A15, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphil
• OMIM: 608275

Protein Summary

• Protein general information: Q8IZD6  
  • Name: Solute carrier family 22 member 15 (Fly like putative transporter 1) (Flipt 1)
  • Length: 547  
  • Mass: 60540
  • Tissue specificity: Expressed at highest levels in kidney and brain. Expressed at high levels in skeletal muscle, heart, liver, placenta and white blood cells. Expressed at moderate levels in lung and spleen. Expressed at low levels in thymus, small intes
• Sequence:

  MEVEEAFQAVGEMGIYQMYLCFLLAVLLQLYVATEAILIALVGATPSYHWDLAELLPNQSHGNQSAGEDQAFGDW
  LLTANGSEIHKHVHFSSSFTSIASEWFLIANRSYKVSAASSFFFSGVFVGVISFGQLSDRFGRKKVYLTGFALDI
  LFAIANGFSPSYEFFAVTRFLVGMMNGGMSLVAFVLLNECVGTAYWALAGSIGGLFFAVGIAQYALLGYFIRSWR
  TLAILVNLQGTVVFLLSLFIPESPRWLYSQGRLSEAEEALYLIAKRNRKLKCTFSLTHPANRSCRETGSFLDLFR
  YRVLLGHTLILMFIWFVCSLVYYGLTLSAGDLGGSIYANLALSGLIEIPSYPLCIYLINQKWFGRKRTLSAFLCL
  GGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGKLTISAAFNIVYIYTSELYPTVIRNVGLGTCSMFSRVGGIIAP
  FIPSLKYVQWSLPFIVFGATGLTSGLLSLLLPETLNSPLLETFSDLQVYSYRRLGEEALSLQALDPQQCVDKESS
  LGSESEEEEEFYDADEETQMIK

• Structural information:
  • Interpro: IPR020846  IPR005828  IPR036259  
  • Prosite: PS50850
  • STRING: ENSP00000358515
• Other Databases: GeneCards:  SLC22A15  Malacards:  SLC22A15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005575	cellular_component	ND	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)