• Gene id: 55353

Gene Summary

• Gene Symbol: LAPTM4B   Gene   UCSC   Ensembl
• Aliases: LAPTM4beta, LC27
• Gene name: lysosomal protein transmembrane 4 beta
• Alternate names: lysosomal-associated transmembrane protein 4B, lysosomal associated protein transmembrane 4 beta, lysosome-associated transmembrane protein 4-beta,
• Gene location: 8q22.1 (97775787: 97853012)     Exons: 7     NC_000008.11
• OMIM: 613296

Protein Summary

• Protein general information: Q86VI4  
  • Name: Lysosomal associated transmembrane protein 4B (Lysosome associated transmembrane protein 4 beta)
  • Length: 317  
  • Mass: 35123
• Sequence:

  MTSRTRVTWPSPPRPLPVPAAAAVAFGAKGTDPAEARSSRGIEEAGPRAHGRAGREPERRRSRQQRRGGLQARRS
  TLLKTCARARATAPGAMKMVAPWTRFYSNSCCLCCHVRTGTILLGVWYLIINAVVLLILLSALADPDQYNFSSSE
  LGGDFEFMDDANMCIAIAISLLMILICAMATYGAYKQRAAWIIPFFCYQIFDFALNMLVAITVLIYPNSIQEYIR
  QLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLISCVWNCYRYINGRNSSDVLVYVTSNDTTVLLPPYDD
  ATVNGAAKEPPPPYVSA

• Structural information:
  • Interpro: IPR004687  IPR018401  
  • STRING: ENSP00000402301
• Other Databases: GeneCards:  LAPTM4B  Malacards:  LAPTM4B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005765	lysosomal membrane	IBA	cellular component
GO:0032911	negative regulation of transforming growth factor beta1 production	IDA	biological process
GO:0005768	endosome	IDA	cellular component
GO:1902936	phosphatidylinositol bisphosphate binding	IDA	molecular function
GO:0032509	endosome transport via multivesicular body sorting pathway	IDA	biological process
GO:0032585	multivesicular body membrane	IDA	cellular component
GO:0031902	late endosome membrane	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0042995	cell projection	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0031902	late endosome membrane	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0031902	late endosome membrane	IDA	cellular component
GO:0032585	multivesicular body membrane	IDA	cellular component
GO:0097001	ceramide binding	IDA	molecular function
GO:0005769	early endosome	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0097487	multivesicular body, internal vesicle	IDA	cellular component
GO:1905166	negative regulation of lysosomal protein catabolic process	IMP	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0007032	endosome organization	IMP	biological process
GO:0097213	regulation of lysosomal membrane permeability	IMP	biological process
GO:1905671	regulation of lysosome organization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0012505	endomembrane system	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0032585	multivesicular body membrane	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04142	Lysosome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq