• Gene id: 55352

Gene Summary

• Gene Symbol: COPRS   Gene   UCSC   Ensembl
• Aliases: C17orf79, COPR5, HSA272196, TTP1
• Gene name: coordinator of PRMT5 and differentiation stimulator
• Alternate names: coordinator of PRMT5 and differentiation stimulator, cooperator of PRMT5, coordinator of PRMT5, differentiation stimulator,
• Gene location: 17q11.2 (31859243: 31851870)     Exons: 5     NC_000017.11

Protein Summary

• Protein general information: Q9NQ92  
  • Name: Coordinator of PRMT5 and differentiation stimulator (Cooperator of PRMT5) (Protein TTP1)
  • Length: 184  
  • Mass: 20066
• Sequence:

  MDLQAAGAQAQGAAEPSRGPPLPSARGAPPSPEAGFATADHSSQERETEKAMDRLARGTQSIPNDSPARGEGTHS
  EEEGFAMDEEDSDGELNTWELSEGTNCPPKEQPGDLFNEDWDSELKADQGNPYDADDIQESISQELKPWVCCAPQ
  GDMIYDPSWHHPPPLIPYYSKMVFETGQFDDAED

• Structural information:
  • Interpro: IPR029289  
  • STRING: ENSP00000304327
• Other Databases: GeneCards:  COPRS  Malacards:  COPRS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042393	histone binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0043985	histone H4-R3 methylation	IBA	biological process
GO:0042393	histone binding	IDA	molecular function
GO:0043985	histone H4-R3 methylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0007517	muscle organ development	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0042393	histone binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0043985	histone H4-R3 methylation	IEA	biological process
GO:0007517	muscle organ development	IEA	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R