• Gene id: 55351

Gene Summary

• Gene Symbol: STK32B   Gene   UCSC   Ensembl
• Aliases: HSA250839, STK32, STKG6, YANK2
• Gene name: serine/threonine kinase 32B
• Alternate names: serine/threonine-protein kinase 32B, gene for serine/threonine protein kinase, yet another novel kinase 2,
• Gene location: 4p16.2 (5051479: 5500993)     Exons: 19     NC_000004.12
• Gene summary(Entrez): This gene encodes a serine-threonine protein kinase. Serine-threonine kinases transfer phosphate molecules to the oxygen atoms of serine and threonine. A genomic deletion affecting this gene has been associated with Ellis-van Creveld syndrome, an autosoma

Protein Summary

• Protein general information: Q9NY57  
  • Name: Serine/threonine protein kinase 32B (EC 2.7.11.1) (Yet another novel kinase 2)
  • Length: 414  
  • Mass: 47883
• Sequence:

  MGGNHSHKPPVFDENEEVNFDHFQILRAIGKGSFGKVCIVQKRDTKKMYAMKYMNKQKCIERDEVRNVFRELQIM
  QGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFTEGTVKLYICELALALEYLQRYHIIHRDIKPD
  NILLDEHGHVHITDFNIATVVKGAERASSMAGTKPYMAPEVFQVYMDRGPGYSYPVDWWSLGITAYELLRGWRPY
  EIHSVTPIDEILNMFKVERVHYSSTWCKGMVALLRKLLTKDPESRVSSLHDIQSVPYLADMNWDAVFKKALMPGF
  VPNKGRLNCDPTFELEEMILESKPLHKKKKRLAKNRSRDGTKDSCPLNGHLQHCLETVREEFIIFNREKLRRQQG
  QGSQLLDTDSRGGGQAQSKLQDGCNNNLLTHTCTRGCSS

• Structural information:
  • Protein Domains: (23..28-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • STRING: ENSP00000282908
• Other Databases: GeneCards:  STK32B  Malacards:  STK32B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq