• Gene id: 55337

Gene Summary

• Gene Symbol: SHFL   Gene   UCSC   Ensembl
• Aliases: C19orf66, IRAV, RyDEN, SFL
• Gene name: shiftless antiviral inhibitor of ribosomal frameshifting
• Alternate names: shiftless antiviral inhibitor of ribosomal frameshifting protein, Repressor of yield of Dengue virus, UPF0515 protein C19orf66, interferon-regulated antiviral, interferon-regulated antiviral protein, repressor of yield of DENV protein, shiftless,
• Gene location: 19p13.2 (10086118: 10093248)     Exons: 3     NC_000019.10
• OMIM: 616808

Protein Summary

• Protein general information: Q9NUL5  
  • Name: Shiftless antiviral inhibitor of ribosomal frameshifting protein (SFL) (SHFL) (Interferon regulated antiviral protein) (IRAV) (Repressor of yield of DENV protein) (RyDEN)
  • Length: 291  
  • Mass: 33110
• Sequence:

  MSQEGVELEKSVRRLREKFHGKVSSKKAGALMRKFGSDHTGVGRSIVYGVKQKDGQELSNDLDAQDPPEDMKQDR
  DIQAVATSLLPLTEANLRMFQRAQDDLIPAVDRQFACSSCDHVWWRRVPQRKEVSRCRKCRKRYEPVPADKMWGL
  AEFHCPKCRHNFRGWAQMGSPSPCYGCGFPVYPTRILPPRWDRDPDRRSTHTHSCSAADCYNRREPHVPGTSCAH
  PKSRKQNHLPKVLHPSNPHISSGSTVATCLSQGGLLEDLDNLILEDLKEEEEEEEEVEDEEGGPRE

• Structural information:
  • Interpro: IPR026795  
  • STRING: ENSP00000253110
• Other Databases: GeneCards:  SHFL  Malacards:  SHFL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051607	defense response to virus	IDA	biological process
GO:0034342	response to type III interferon	IDA	biological process
GO:0034341	response to interferon-gamma	IDA	biological process
GO:0034340	response to type I interferon	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:1990825	sequence-specific mRNA binding	IDA	molecular function
GO:0043022	ribosome binding	IDA	molecular function
GO:0019034	viral replication complex	IDA	cellular component
GO:0000932	P-body	IDA	cellular component
GO:0006449	regulation of translational termination	IDA	biological process
GO:0075523	viral translational frameshifting	IDA	biological process
GO:2001125	negative regulation of translational frameshifting	IDA	biological process
GO:0035456	response to interferon-beta	IDA	biological process
GO:0003723	RNA binding	IDA	molecular function
GO:0045071	negative regulation of viral genome replication	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0051607	defense response to virus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000932	P-body	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray