• Gene id: 5533

Gene Summary

• Gene Symbol: PPP3CC   Gene   UCSC   Ensembl
• Aliases: CALNA3, CNA3, PP2Bgamma
• Gene name: protein phosphatase 3 catalytic subunit gamma
• Alternate names: serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform, CAM-PRP catalytic subunit, calcineurin, testis-specific catalytic subunit, calmodulin-dependent calcineurin A subunit gamma isoform, protein phosphatase 2B, catalytic subunit, gamma isof,
• Gene location: 8p21.3 (22440969: 22541465)     Exons: 18     NC_000008.11
• Gene summary(Entrez): Calcineurin is a calcium-dependent, calmodulin-stimulated protein phosphatase involved in the downstream regulation of dopaminergic signal transduction. Calcineurin is composed of a regulatory subunit and a catalytic subunit. The protein encoded by this g
• OMIM: 114107

Protein Summary

• Protein general information: P48454  
  • Name: Serine/threonine protein phosphatase 2B catalytic subunit gamma isoform (EC 3.1.3.16) (CAM PRP catalytic subunit) (Calcineurin, testis specific catalytic subunit) (Calmodulin dependent calcineurin A subunit gamma isoform)
  • Length: 512  
  • Mass: 58129
  • Tissue specificity: Testis. {ECO
• Sequence:

  MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKIINDGAAILRQEKTMI
  EVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGYFSIECVLYLWSLKINHPKTLFLLRGNHECR
  HLTDYFTFKQECRIKYSEQVYDACMETFDCLPLAALLNQQFLCVHGGMSPEITSLDDIRKLDRFTEPPAFGPVCD
  LLWSDPSEDYGNEKTLEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLIT
  IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELIS
  DDEAEGSTTVRKEIIRNKIRAIGKMARVFSILRQESESVLTLKGLTPTGTLPLGVLSGGKQTIETATVEAVEARE
  AIRGFSLQHKIRSFEEARGLDRINERMPPRKDSIHAGGPMKSVTSAHSHAAHRSDQGKKAHS

• Structural information:
  • Interpro: IPR004843  IPR029052  IPR041751  IPR006186  
  • Prosite: PS00125
  • CDD: cd07416
  • STRING: ENSP00000380878
• Other Databases: GeneCards:  PPP3CC  Malacards:  PPP3CC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0097720	calcineurin-mediated signaling	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0033192	calmodulin-dependent protein phosphatase activity	IBA	molecular function
GO:0005955	calcineurin complex	IBA	cellular component
GO:0005516	calmodulin binding	IBA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0033192	calmodulin-dependent protein phosphatase activity	IEA	molecular function
GO:0097720	calcineurin-mediated signaling	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:1900740	positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007420	brain development	IEA	biological process
GO:0098793	presynapse	IEA	cellular component
GO:1900242	regulation of synaptic vesicle endocytosis	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:1900244	positive regulation of synaptic vesicle endocytosis	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0099523	presynaptic cytosol	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0006470	protein dephosphorylation	IDA	biological process
GO:0033173	calcineurin-NFAT signaling cascade	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0033192	calmodulin-dependent protein phosphatase activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa04010	MAPK signaling pathway
hsa05166	Human T-cell leukemia virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa04020	Calcium signaling pathway
hsa04360	Axon guidance
hsa05170	Human immunodeficiency virus 1 infection
hsa04310	Wnt signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05152	Tuberculosis
hsa04921	Oxytocin signaling pathway
hsa04218	Cellular senescence
hsa04728	Dopaminergic synapse
hsa04724	Glutamatergic synapse
hsa04380	Osteoclast differentiation
hsa04114	Oocyte meiosis
hsa04922	Glucagon signaling pathway
hsa04650	Natural killer cell mediated cytotoxicity
hsa04625	C-type lectin receptor signaling pathway
hsa04660	T cell receptor signaling pathway
hsa04659	Th17 cell differentiation
hsa04662	B cell receptor signaling pathway
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa04658	Th1 and Th2 cell differentiation
hsa04720	Long-term potentiation
hsa05031	Amphetamine addiction
hsa04924	Renin secretion
hsa05014	Amyotrophic lateral sclerosis
hsa04370	VEGF signaling pathway

Diseases

Associated diseases	References
Schizophrenia	PMID:15820226
Schizophrenia	PMID:12851458
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R