• Gene id: 55328

Gene Summary

• Gene Symbol: RNLS   Gene   UCSC   Ensembl
• Aliases: C10orf59, RENALASE
• Gene name: renalase, FAD dependent amine oxidase
• Alternate names: renalase, MAO-C, alpha-NAD(P)H oxidase/anomerase, monoamine oxidase-C,
• Gene location: 10q23.31 (88584479: 88176051)     Exons: 16     NC_000010.11
• Gene summary(Entrez): Renalase is a flavin adenine dinucleotide-dependent amine oxidase that is secreted into the blood from the kidney (Xu et al., 2005 [PubMed 15841207]).[supplied by OMIM, Mar 2008]
• OMIM: 605754

Protein Summary

• Protein general information: Q5VYX0  
  • Name: Renalase (EC 1.6.3.5) (Monoamine oxidase C) (MAO C)
  • Length: 342  
  • Mass: 37847
  • Tissue specificity: Secreted into the blood by the kidney. Highly expressed in the kidney, expressed at lower level in heart, skeletal muscle and small intestine. Its plasma concentration is markedly reduced in patients with end-stage renal disease, as co
• Sequence:

  MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKAEDSGGRMTTACSPHNPQCTADLGAQYITCTPHYAKKHQR
  FYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDDKWEVSKQTGS
  PEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVS
  IDNKKRNIESSEIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANC
  PGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI

• Structural information:
  • Interpro: IPR002937  IPR036188  IPR040174  
  • PDB: 3QJ4
  • PDBsum: 3QJ4
  • STRING: ENSP00000332530
• Other Databases: GeneCards:  RNLS  Malacards:  RNLS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016651	oxidoreductase activity, acting on NAD(P)H	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0034356	NAD biosynthesis via nicotinamide riboside salvage pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0002931	response to ischemia	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0071869	response to catecholamine	IEA	biological process
GO:1902074	response to salt	IEA	biological process
GO:0071871	response to epinephrine	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0070404	NADH binding	IDA	molecular function
GO:0010459	negative regulation of heart rate	IDA	biological process
GO:0016651	oxidoreductase activity, acting on NAD(P)H	IDA	molecular function
GO:0005576	extracellular region	IDA	cellular component
GO:0051379	epinephrine binding	IDA	molecular function
GO:0045776	negative regulation of blood pressure	IDA	biological process
GO:0016651	oxidoreductase activity, acting on NAD(P)H	IDA	molecular function
GO:0055114	oxidation-reduction process	IMP	biological process
GO:0097621	monoamine oxidase activity	IMP	molecular function

Diseases

Associated diseases	References
Hypertension	PMID:21617193
Essential hypertension	PMID:17216203
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881