• Gene id: 55323

Gene Summary

• Gene Symbol: LARP6   Gene   UCSC   Ensembl
• Aliases: ACHN
• Gene name: La ribonucleoprotein 6, translational regulator
• Alternate names: la-related protein 6, La ribonucleoprotein domain family member 6, acheron, death-associated LA motif protein,
• Gene location: 15q23 (70854156: 70829129)     Exons: 5     NC_000015.10
• OMIM: 611300

Protein Summary

• Protein general information: Q9BRS8  
  • Name: La related protein 6 (Acheron) (Achn) (La ribonucleoprotein domain family member 6)
  • Length: 491  
  • Mass: 54737
  • Tissue specificity: Expressed in numerous tissues. {ECO
• Sequence:

  MAQSGGEARPGPKTAVQIRVAIQEAEDVDELEDEEEGAETRGAGDPARYLSPGWGSASEEEPSRGHSGTTASGGE
  NEREDLEQEWKPPDEELIKKLVDQIEFYFSDENLEKDAFLLKHVRRNKLGYVSVKLLTSFKKVKHLTRDWRTTAH
  ALKYSVVLELNEDHRKVRRTTPVPLFPNENLPSKMLLVYDLYLSPKLWALATPQKNGRVQEKVMEHLLKLFGTFG
  VISSVRILKPGRELPPDIRRISSRYSQVGTQECAIVEFEEVEAAIKAHEFMITESQGKENMKAVLIGMKPPKKKP
  AKDKNHDEEPTASIHLNKSLNKRVEELQYMGDESSANSSSDPESNPTSPMAGRRHAATNKLSPSGHQNLFLSPNA
  SPCTSPWSSPLAQRKGVSRKSPLAEEGRLNCSTSPEIFRKCMDYSSDSSVTPSGSPWVRRRRQAEMGTQEKSPGT
  SPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRACV

• Structural information:
  • Protein Domains: (86..17-)
    RNA-binding (/note="HTH-La-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00332-)
    (184..29-)
    (/note="RRM"-)
  • Interpro: IPR006630  IPR034886  IPR034880  IPR002344  IPR012677   IPR035979  IPR024642  IPR036388  IPR036390  
  • Prosite: PS50961
  • CDD: cd12289
  • PDB: 2MTF 2MTG
  • PDBsum: 2MTF 2MTG
  • STRING: ENSP00000299213
• Other Databases: GeneCards:  LARP6  Malacards:  LARP6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990825	sequence-specific mRNA binding	IDA	molecular function
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0005844	polysome	IDA	cellular component
GO:1902416	positive regulation of mRNA binding	IDA	biological process
GO:0048027	mRNA 5'-UTR binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006396	RNA processing	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:1990904	ribonucleoprotein complex	IEA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006417	regulation of translation	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005844	polysome	IDA	cellular component
GO:0035613	RNA stem-loop binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0048027	mRNA 5'-UTR binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005844	polysome	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:1990904	ribonucleoprotein complex	IMP	cellular component
GO:1902416	positive regulation of mRNA binding	IMP	biological process
GO:0048027	mRNA 5'-UTR binding	IMP	molecular function
GO:0017022	myosin binding	IPI	molecular function
GO:0017022	myosin binding	IPI	molecular function
GO:0035613	RNA stem-loop binding	IMP	molecular function
GO:0032967	positive regulation of collagen biosynthetic process	IMP	biological process
GO:0045727	positive regulation of translation	IMP	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray