• Gene id: 55314

Gene Summary

• Gene Symbol: TMEM144   Gene   UCSC   Ensembl
• Gene name: transmembrane protein 144
• Alternate names: transmembrane protein 144,
• Gene location: 4q32.1 (158201596: 158255415)     Exons: 16     NC_000004.12

Protein Summary

• Protein general information: Q7Z5S9  
  • Name: Transmembrane protein 144
  • Length: 345  
  • Mass: 37653
• Sequence:

  MSNNGADLTFGYISCFVAILLFGSNFVPLKKFDTGDGMFLQWVLCAAIWLVALVVNLILHCPKFWPFAMLGGCIW
  ATGNIAVVPIIKTIGLGLGILIWGSFNALTGWASSRFGWFGLDAEEVSNPLLNYIGAGLSVVSAFIFLFIKSEIP
  NNTCSMDTTPLITEHVINTTQDPCSWVDKLSTVHHRIVGCSLAVISGVLYGSTFVPIIYIKDHSKRNDSIYAGAS
  QYDLDYVFAHFSGIFLTSTVYFLAYCIAMKNSPKLYPEAVLPGFLSGVLWAIATCCWFIANHSLSAVVSFPIITA
  GPGFIAAMWGIFMFKEIKGLQNYLLMILAFCIILTGALCTAFSKI

• Structural information:
  • Interpro: IPR010651  IPR012435  
  • STRING: ENSP00000296529
• Other Databases: GeneCards:  TMEM144  Malacards:  TMEM144

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015144	carbohydrate transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0034219	carbohydrate transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R