• Gene id: 55312

Gene Summary

• Gene Symbol: RFK   Gene   UCSC   Ensembl
• Aliases: RIFK
• Gene name: riboflavin kinase
• Alternate names: riboflavin kinase, 0610038L10Rik, ATP:riboflavin 5'-phosphotransferase, flavokinase,
• Gene location: 9q21.13 (76394425: 76385525)     Exons: 4     NC_000009.12
• Gene summary(Entrez): Riboflavin kinase (RFK; EC 2.7.1.26) is an essential enzyme that catalyzes the phosphorylation of riboflavin (vitamin B2) to form flavin mononucleotide (FMN), an obligatory step in vitamin B2 utilization and flavin cofactor synthesis (Karthikeyan et al.,
• OMIM: 613010

Protein Summary

• Protein general information: Q969G6  
  • Name: Riboflavin kinase (EC 2.7.1.26) (ATP:riboflavin 5' phosphotransferase) (Flavokinase)
  • Length: 155  
  • Mass: 17623
  • Tissue specificity: Detected in brain, placenta and urinary bladder.
• Sequence:

  MRHLPYFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADISTGIYYGWASVGSGDVHKMVVSIGWNPYYKNTK
  KSMETHIMHTFKEDFYGEILNVAIVGYLRPEKNFDSLESLISAIQGDIEEAKKRLELPEHLKIKEDNFFQVSKSK
  IMNGH

• Structural information:
  • Interpro: IPR023468  IPR015865  IPR023465  
  • PDB: 1NB0 1NB9 1P4M 1Q9S
  • PDBsum: 1NB0 1NB9 1P4M 1Q9S
  • DIP: 60454
  • STRING: ENSP00000365926
• Other Databases: GeneCards:  RFK  Malacards:  RFK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009398	FMN biosynthetic process	IBA	biological process
GO:0008531	riboflavin kinase activity	IBA	molecular function
GO:0006771	riboflavin metabolic process	IBA	biological process
GO:0008531	riboflavin kinase activity	IEA	molecular function
GO:0009231	riboflavin biosynthetic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0008531	riboflavin kinase activity	IEA	molecular function
GO:0033864	positive regulation of NAD(P)H oxidase activity	IMP	biological process
GO:0006915	apoptotic process	IMP	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0006771	riboflavin metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0072593	reactive oxygen species metabolic process	IEA	biological process
GO:0033864	positive regulation of NAD(P)H oxidase activity	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0009398	FMN biosynthetic process	IEA	biological process
GO:0005737	cytoplasm	NAS	cellular component
GO:0009231	riboflavin biosynthetic process	NAS	biological process
GO:0008531	riboflavin kinase activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00740	Riboflavin metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)