• Gene id: 55311

Gene Summary

• Gene Symbol: ZNF444   Gene   UCSC   Ensembl
• Aliases: EZF-2, EZF2, ZSCAN17
• Gene name: zinc finger protein 444
• Alternate names: zinc finger protein 444, endothelial zinc finger protein 2, zinc finger and SCAN domain-containing protein 17,
• Gene location: 19q13.43 (56132508: 56160892)     Exons: 12     NC_000019.10
• Gene summary(Entrez): This gene encodes a zinc finger protein which activates transcription of a scavenger receptor gene involved in the degradation of acetylated low density lipoprotein (Ac-LDL) (PMID: 11978792). This gene is located in a cluster of zinc finger genes on chrom
• OMIM: 607874

Protein Summary

• Protein general information: Q8N0Y2  
  • Name: Zinc finger protein 444 (Endothelial zinc finger protein 2) (EZF 2) (Zinc finger and SCAN domain containing protein 17)
  • Length: 327  
  • Mass: 35204
• Sequence:

  MEVAVPVKQEAEGLALDSPWHRFRRFHLGDAPGPREALGLLRALCRDWLRPEVHTKEQMLELLVLEQFLSALPAD
  TQAWVCSRQPQSGEEAVALLEELWGPAASPDGSSATRVPQDVTQGPGATGGKEDSGMIPLAGTAPGAEGPAPGDS
  QAVRPYKQEPSSPPLAPGLPAFLAAPGTTSCPECGKTSLKPAHLLRHRQSHSGEKPHACPECGKAFRRKEHLRRH
  RDTHPGSPGSPGPALRPLPAREKPHACCECGKTFYWREHLVRHRKTHSGARPFACWECGKGFGRREHVLRHQRIH
  GRAAASAQGAVAPGPDGGGPFPPWPLG

• Structural information:
  • Protein Domains: (20..10-)
    (/note="SCAN-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00187"-)
  • Interpro: IPR003309  IPR038269  IPR036236  IPR013087  
  • Prosite: PS50804 PS00028 PS50157
  • CDD: cd07936
  • STRING: ENSP00000338860
• Other Databases: GeneCards:  ZNF444  Malacards:  ZNF444

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881