• Gene id: 55303

Gene Summary

• Gene Symbol: GIMAP4   Gene   UCSC   Ensembl
• Aliases: IAN-1, IAN1, IMAP4, MSTP062
• Gene name: GTPase, IMAP family member 4
• Alternate names: GTPase IMAP family member 4, human immune associated nucleotide 1, immune-associated nucleotide-binding protein 1, immunity associated protein 4, immunity-associated nucleotide 1 protein,
• Gene location: 7q36.1 (150567369: 150573952)     Exons: 3     NC_000007.14
• Gene summary(Entrez): This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. The encoded protein of this gene may be negatively regulated by T-cell acute lymphocytic leukemia
• OMIM: 618448

Protein Summary

• Protein general information: Q9NUV9  
  • Name: GTPase IMAP family member 4 (Immunity associated nucleotide 1 protein) (IAN 1) (hIAN1) (Immunity associated protein 4)
  • Length: 329  
  • Mass: 37534
  • Tissue specificity: Highly expressed in spleen and peripheral blood leukocytes that contain mostly T- and B-lymphocytes. Expressed specifically in resting T- and B-lymphocytes and expression significantly decreases during B- or T-lymphocyte activation. Ex
• Sequence:

  MAAQYGSMSFNPSTPGASYGPGRQEPRNSQLRIVLVGKTGAGKSATGNSILGRKVFHSGTAAKSITKKCEKRSSS
  WKETELVVVDTPGIFDTEVPNAETSKEIIRCILLTSPGPHALLLVVPLGRYTEEEHKATEKILKMFGERARSFMI
  LIFTRKDDLGDTNLHDYLREAPEDIQDLMDIFGDRYCALNNKATGAEQEAQRAQLLGLIQRVVRENKEGCYTNRM
  YQRAEEEIQKQTQAMQELHRVELEREKARIREEYEEKIRKLEDKVEQEKRKKQMEKKLAEQEAHYAVRQQRARTE
  VESKDGILELIMTALQIASFILLRLFAED

• Structural information:
  • Protein Domains: (28..23-)
    (/note="AIG1-type-G)
    (233..26-)
    (/note="IQ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00116"-)
  • Interpro: IPR006703  IPR027417  
  • Prosite: PS51720
  • PDB: 3LXX
  • PDBsum: 3LXX
  • STRING: ENSP00000255945
• Other Databases: GeneCards:  GIMAP4  Malacards:  GIMAP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R