• Gene id: 55300

Gene Summary

• Gene Symbol: PI4K2B   Gene   UCSC   Ensembl
• Aliases: PI4KIIB, PIK42B
• Gene name: phosphatidylinositol 4-kinase type 2 beta
• Alternate names: phosphatidylinositol 4-kinase type 2-beta, PI4KII-BETA, phosphatidylinositol 4-kinase type-II beta,
• Gene location: 4p15.2 (98117292: 98159840)     Exons: 18     NC_000008.11
• Gene summary(Entrez): This gene encodes a member of the type II PI4 kinase protein family. The encoded protein is primarily cytosolic and contributes to overall PI4-kinase activity along with other protein family members. This protein is involved in early T cell activation. [p
• OMIM: 612101

Protein Summary

• Protein general information: Q8TCG2  
  • Name: Phosphatidylinositol 4 kinase type 2 beta (EC 2.7.1.67) (Phosphatidylinositol 4 kinase type II beta) (PI4KII BETA)
  • Length: 481  
  • Mass: 54744
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MEDPSEPDRLASADGGSPEEEEDGEREPLLPRIAWAHPRRGAPGSAVRLLDAAGEEGEAGDEELPLPPGDVGVSR
  SSSAELDRSRPAVSVTIGTSEMNAFLDDPEFADIMLRAEQAIEVGIFPERISQGSSGSYFVKDPKRKIIGVFKPK
  SEEPYGQLNPKWTKYVHKVCCPCCFGRGCLIPNQGYLSEAGAYLVDNKLHLSIVPKTKVVWLVSETFNYNAIDRA
  KSRGKKYALEKVPKVGRKFHRIGLPPKIGSFQLFVEGYKEAEYWLRKFEADPLPENIRKQFQSQFERLVILDYII
  RNTDRGNDNWLVRYEKQKCEKEIDHKESKWIDDEEFLIKIAAIDNGLAFPFKHPDEWRAYPFHWAWLPQAKVPFS
  EEIRNLILPYISDMNFVQDLCEDLYELFKTDKGFDKATFESQMSVMRGQILNLTQALRDGKSPFQLVQIPCVIVE
  RSQGGSQGRIVHLSNSFTQTVNCRKPFFSSW

• Structural information:
  • Protein Domains: (129..43-)
    (/note="PI3K/PI4K"-)
  • Interpro: IPR039756  IPR000403  
  • PDB: 4WTV
  • PDBsum: 4WTV
  • STRING: ENSP00000264864
• Other Databases: GeneCards:  PI4K2B  Malacards:  PI4K2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007032	endosome organization	IBA	biological process
GO:0005802	trans-Golgi network	IBA	cellular component
GO:0005768	endosome	IBA	cellular component
GO:0046854	phosphatidylinositol phosphorylation	IBA	biological process
GO:0007030	Golgi organization	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0004430	1-phosphatidylinositol 4-kinase activity	IBA	molecular function
GO:0004430	1-phosphatidylinositol 4-kinase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004430	1-phosphatidylinositol 4-kinase activity	IEA	molecular function
GO:0006661	phosphatidylinositol biosynthetic process	TAS	biological process
GO:0006661	phosphatidylinositol biosynthetic process	TAS	biological process
GO:0006661	phosphatidylinositol biosynthetic process	TAS	biological process
GO:0006661	phosphatidylinositol biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04070	Phosphatidylinositol signaling system
hsa00562	Inositol phosphate metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)