• Gene id: 5530

Gene Summary

• Gene Symbol: PPP3CA   Gene   UCSC   Ensembl
• Aliases: ACCIID, CALN, CALNA, CALNA1, CCN1, CNA1, IECEE, IECEE1, PPP2B
• Gene name: protein phosphatase 3 catalytic subunit alpha
• Alternate names: serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform, CAM-PRP catalytic subunit, calcineurin A alpha, calmodulin-dependent calcineurin A subunit alpha isoform, protein phosphatase 2B, catalytic subunit, alpha isoform, protein phosphatase 3 (,
• Gene location: 4q24 (101348294: 101023417)     Exons: 16     NC_000004.12
• OMIM: 114105

Protein Summary

• Protein general information: Q08209  
  • Name: Serine/threonine protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM PRP catalytic subunit) (Calmodulin dependent calcineurin A subunit alpha isoform)
  • Length: 521  
  • Mass: 58688
  • Tissue specificity: Expressed in keratinocytes (at protein level). {ECO
• Sequence:

  MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQE
  KNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGN
  HECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYG
  PMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
  SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDD
  ELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVE
  AIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ

• Structural information:
  • Interpro: IPR004843  IPR029052  IPR041751  IPR006186  
  • Prosite: PS00125
  • CDD: cd07416
  • PDB: 1AUI 1M63 1MF8 2JOG 2JZI 2P6B 2R28 2W73 3LL8 4F0Z 4Q5U 5C1V 5SVE 6NUC 6NUF 6NUU
  • PDBsum: 1AUI 1M63 1MF8 2JOG 2JZI 2P6B 2R28 2W73 3LL8 4F0Z 4Q5U 5C1V 5SVE 6NUC 6NUF 6NUU
  • DIP: 6095
  • STRING: ENSP00000378323
• Other Databases: GeneCards:  PPP3CA  Malacards:  PPP3CA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0019897	extrinsic component of plasma membrane	IC	cellular component
GO:0051117	ATPase binding	IPI	molecular function
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0045785	positive regulation of cell adhesion	IMP	biological process
GO:0033173	calcineurin-NFAT signaling cascade	IMP	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0033173	calcineurin-NFAT signaling cascade	IBA	biological process
GO:0097720	calcineurin-mediated signaling	IBA	biological process
GO:0005516	calmodulin binding	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0005955	calcineurin complex	IBA	cellular component
GO:0033192	calmodulin-dependent protein phosphatase activity	IBA	molecular function
GO:0051592	response to calcium ion	IDA	biological process
GO:0033192	calmodulin-dependent protein phosphatase activity	IDA	molecular function
GO:0006470	protein dephosphorylation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0033192	calmodulin-dependent protein phosphatase activity	IEA	molecular function
GO:0097720	calcineurin-mediated signaling	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0007223	Wnt signaling pathway, calcium modulating pathway	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903244	positive regulation of cardiac muscle hypertrophy in response to stress	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IEA	biological process
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process
GO:0050774	negative regulation of dendrite morphogenesis	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0035562	negative regulation of chromatin binding	IEA	biological process
GO:0033555	multicellular organismal response to stress	IEA	biological process
GO:0033173	calcineurin-NFAT signaling cascade	IEA	biological process
GO:0030018	Z disc	IEA	cellular component
GO:0019722	calcium-mediated signaling	IEA	biological process
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0006606	protein import into nucleus	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0007420	brain development	IEA	biological process
GO:0004723	calcium-dependent protein serine/threonine phosphatase activity	IEA	molecular function
GO:0004722	protein serine/threonine phosphatase activity	IEA	molecular function
GO:1905205	positive regulation of connective tissue replacement	IEA	biological process
GO:1903799	negative regulation of production of miRNAs involved in gene silencing by miRNA	IEA	biological process
GO:0099170	postsynaptic modulation of chemical synaptic transmission	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0048741	skeletal muscle fiber development	IEA	biological process
GO:0045807	positive regulation of endocytosis	IEA	biological process
GO:0033192	calmodulin-dependent protein phosphatase activity	IEA	molecular function
GO:0016311	dephosphorylation	IEA	biological process
GO:0014898	cardiac muscle hypertrophy in response to stress	IEA	biological process
GO:0014883	transition between fast and slow fiber	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0010613	positive regulation of cardiac muscle hypertrophy	IEA	biological process
GO:0006816	calcium ion transport	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0005955	calcineurin complex	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005516	calmodulin binding	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0000082	G1/S transition of mitotic cell cycle	IEA	biological process
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:0046676	negative regulation of insulin secretion	IEA	biological process
GO:0036057	slit diaphragm	IEA	cellular component
GO:0033192	calmodulin-dependent protein phosphatase activity	IEA	molecular function
GO:0007568	aging	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0005955	calcineurin complex	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005516	calmodulin binding	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0001975	response to amphetamine	IEA	biological process
GO:0043403	skeletal muscle tissue regeneration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005955	calcineurin complex	IDA	cellular component
GO:0033173	calcineurin-NFAT signaling cascade	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0042060	wound healing	TAS	biological process
GO:0030018	Z disc	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0042383	sarcolemma	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005955	calcineurin complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016018	cyclosporin A binding	IDA	molecular function
GO:0035690	cellular response to drug	IDA	biological process
GO:0005516	calmodulin binding	IDA	molecular function
GO:0008144	drug binding	IDA	molecular function
GO:0019899	enzyme binding	IDA	molecular function
GO:0043197	dendritic spine	IDA	cellular component
GO:0033173	calcineurin-NFAT signaling cascade	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005955	calcineurin complex	IDA	cellular component
GO:0005516	calmodulin binding	IDA	molecular function
GO:0033192	calmodulin-dependent protein phosphatase activity	IDA	molecular function
GO:0005955	calcineurin complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0033192	calmodulin-dependent protein phosphatase activity	IDA	molecular function
GO:0005955	calcineurin complex	IDA	cellular component
GO:0009898	cytoplasmic side of plasma membrane	IDA	colocalizes with
GO:0005516	calmodulin binding	IDA	molecular function
GO:0016018	cyclosporin A binding	IDA	molecular function
GO:0005955	calcineurin complex	IDA	cellular component
GO:0006470	protein dephosphorylation	IDA	biological process
GO:0033192	calmodulin-dependent protein phosphatase activity	TAS	molecular function
GO:0016311	dephosphorylation	TAS	biological process
GO:0005955	calcineurin complex	NAS	cellular component
GO:0005516	calmodulin binding	NAS	molecular function
GO:0046983	protein dimerization activity	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004722	protein serine/threonine phosphatase activity	NAS	molecular function
GO:0004722	protein serine/threonine phosphatase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042110	T cell activation	TAS	biological process
GO:0006470	protein dephosphorylation	NAS	biological process
GO:0005509	calcium ion binding	NAS	molecular function
GO:0070262	peptidyl-serine dephosphorylation	IMP	biological process
GO:0046983	protein dimerization activity	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0033173	calcineurin-NFAT signaling cascade	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006470	protein dephosphorylation	IMP	biological process
GO:0033173	calcineurin-NFAT signaling cascade	IMP	biological process
GO:0033173	calcineurin-NFAT signaling cascade	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa04010	MAPK signaling pathway
hsa05166	Human T-cell leukemia virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa04020	Calcium signaling pathway
hsa04360	Axon guidance
hsa05170	Human immunodeficiency virus 1 infection
hsa04310	Wnt signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05152	Tuberculosis
hsa04921	Oxytocin signaling pathway
hsa04218	Cellular senescence
hsa04728	Dopaminergic synapse
hsa04724	Glutamatergic synapse
hsa04380	Osteoclast differentiation
hsa04114	Oocyte meiosis
hsa04922	Glucagon signaling pathway
hsa04650	Natural killer cell mediated cytotoxicity
hsa04625	C-type lectin receptor signaling pathway
hsa04660	T cell receptor signaling pathway
hsa04659	Th17 cell differentiation
hsa04662	B cell receptor signaling pathway
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa04658	Th1 and Th2 cell differentiation
hsa04720	Long-term potentiation
hsa05031	Amphetamine addiction
hsa04924	Renin secretion
hsa05014	Amyotrophic lateral sclerosis
hsa04370	VEGF signaling pathway
P06959	CCKR signaling map

Diseases

Associated diseases	References
Infantile or early childhood epileptic encephalopathy	KEGG:H02150
Infantile or early childhood epileptic encephalopathy	KEGG:H02150
focal segmental glomerulosclerosis	PMID:26436650
Schizophrenia	PMID:15820226
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881