• Gene id: 55297

Gene Summary

• Gene Symbol: CCDC91   Gene   UCSC   Ensembl
• Aliases: HSD8, p56
• Gene name: coiled-coil domain containing 91
• Alternate names: coiled-coil domain-containing protein 91, GGA-binding partner, p56 accessory protein,
• Gene location: 12p11.22 (28190445: 28550165)     Exons: 21     NC_000012.12
• OMIM: 617366

Protein Summary

• Protein general information: Q7Z6B0  
  • Name: Coiled coil domain containing protein 91 (GGA binding partner) (p56 accessory protein)
  • Length: 441  
  • Mass: 49971
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MDDDDFGGFEAAETFDGGSGETQTTSPAIPWAAFPAVSGVHLSPSSPEIVLDRDHSSSIGCLSSDAIISSPENTH
  AANSIVSQTIPKAQIQQSTHTHLDISLFPLGLTDEKSNGTIALVDDSEDPGANVSNIQLQQKISSLEIKLKVSEE
  EKQRIKQDVESLMEKHNVLEKGFLKEKEQEAISFQDRYKELQEKHKQELEDMRKAGHEALSIIVDEYKALLQSSV
  KQQVEAIEKQYISAIEKQAHKCEELLNAQHQRLLEMLDTEKELLKEKIKEALIQQSQEQKEILEKCLEEERQRNK
  EALVSAAKLEKEAVKDAVLKVVEEERKNLEKAHAEERELWKTEHAKDQEKVSQEIQKAIQEQRKISQETVKAAII
  EEQKRSEKAVEEAVKRTRDELIEYIKEQKRLDQVIRQRSLSSLELFLSCAQKQLSALIATEPVDIE

• Structural information:
  • Interpro: IPR034592  
  • PDB: 1OM9
  • PDBsum: 1OM9
  • STRING: ENSP00000438040
• Other Databases: GeneCards:  CCDC91  Malacards:  CCDC91

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090160	Golgi to lysosome transport	IBA	biological process
GO:0005802	trans-Golgi network	IBA	cellular component
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0090160	Golgi to lysosome transport	IMP	biological process
GO:0048193	Golgi vesicle transport	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 21412036
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21412036	Cryptorchidism			23 (4 controls, 19 cases)	Male infertility	GSE25518 analyzed by GEO2R (cutoff 1.5 fold)