• Gene id: 55294

Gene Summary

• Gene Symbol: FBXW7   Gene   UCSC   Ensembl
• Aliases: AGO, CDC4, FBW6, FBW7, FBX30, FBXO30, FBXW6, SEL-10, SEL10, hAgo, hCdc4
• Gene name: F-box and WD repeat domain containing 7
• Alternate names: F-box/WD repeat-containing protein 7, F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase, F-box and WD-40 domain protein 7 (archipelago homolog, Drosophila), F-box protein FBW7, F-box protein FBX30, F-box protein SEL-10, archipelago, homolog of,
• Gene location: 4q31.3 (152536872: 152320543)     Exons: 18     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), w
• OMIM: 606278

Protein Summary

• Protein general information: Q969H0  
  • Name: F box/WD repeat containing protein 7 (Archipelago homolog) (hAgo) (F box and WD 40 domain containing protein 7) (F box protein FBX30) (SEL 10) (hCdc4)
  • Length: 707  
  • Mass: 79663
  • Tissue specificity: Isoform 1 is widely expressed. Isoform 3 is expressed in brain. {ECO
• Sequence:

  MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVVGVEPRPGGQNDSQQG
  QLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQESDDFDQSDDSSREDEHTHTNSVTNSSSIV
  DLPVHQLSSPFYTKTTKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRI
  TSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKD
  LLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKV
  LKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAET
  GECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKV
  WDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNAD
  STVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRI
  RASNTKLVCAVGSRNGTEETKLLVLDFDVDMK

• Structural information:
  • Protein Domains: (278..32-)
    (/note="F-box-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00080"-)
  • Interpro: IPR036047  IPR001810  IPR020472  IPR015943  IPR001680   IPR019775  IPR017986  IPR036322  
  • Prosite: PS50181 PS00678 PS50082 PS50294
  • PDB: 2OVP 2OVQ 2OVR 5IBK 5V4B
  • PDBsum: 2OVP 2OVQ 2OVR 5IBK 5V4B
  • DIP: 27613
  • STRING: ENSP00000281708
• Other Databases: GeneCards:  FBXW7  Malacards:  FBXW7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0097027	ubiquitin-protein transferase activator activity	IDA	molecular function
GO:0030332	cyclin binding	IDA	molecular function
GO:1903378	positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IDA	biological process
GO:0030674	protein-macromolecule adaptor activity	IDA	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:1903146	regulation of autophagy of mitochondrion	IMP	biological process
GO:0051443	positive regulation of ubiquitin-protein transferase activity	IDA	biological process
GO:1903955	positive regulation of protein targeting to mitochondrion	IMP	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0019005	SCF ubiquitin ligase complex	IDA	cellular component
GO:1901800	positive regulation of proteasomal protein catabolic process	IDA	biological process
GO:1990452	Parkin-FBXW7-Cul1 ubiquitin ligase complex	IPI	cellular component
GO:0031398	positive regulation of protein ubiquitination	IDA	biological process
GO:1902806	regulation of cell cycle G1/S phase transition	TAS	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0010992	ubiquitin recycling	IBA	biological process
GO:0043130	ubiquitin binding	IBA	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0050816	phosphothreonine residue binding	IDA	molecular function
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0019005	SCF ubiquitin ligase complex	IDA	cellular component
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0019005	SCF ubiquitin ligase complex	IDA	cellular component
GO:0016567	protein ubiquitination	IDA	biological process
GO:2001205	negative regulation of osteoclast development	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030332	cyclin binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042752	regulation of circadian rhythm	IMP	biological process
GO:2000060	positive regulation of ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0048511	rhythmic process	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016567	protein ubiquitination	IDA	biological process
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2001205	negative regulation of osteoclast development	IEA	biological process
GO:1903378	positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IEA	biological process
GO:0090049	regulation of cell migration involved in sprouting angiogenesis	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0031648	protein destabilization	IEA	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0001570	vasculogenesis	IEA	biological process
GO:2000060	positive regulation of ubiquitin-dependent protein catabolic process	IEA	biological process
GO:1903026	negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding	IEA	biological process
GO:1901800	positive regulation of proteasomal protein catabolic process	IEA	biological process
GO:0042752	regulation of circadian rhythm	IEA	biological process
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0050821	protein stabilization	IDA	biological process
GO:0045741	positive regulation of epidermal growth factor-activated receptor activity	IDA	biological process
GO:2000060	positive regulation of ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0001944	vasculature development	TAS	biological process
GO:0007062	sister chromatid cohesion	IMP	biological process
GO:0010868	negative regulation of triglyceride biosynthetic process	ISS	biological process
GO:0010883	regulation of lipid storage	ISS	biological process
GO:0045746	negative regulation of Notch signaling pathway	ISS	biological process
GO:0032880	regulation of protein localization	ISS	biological process
GO:0055088	lipid homeostasis	ISS	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:2000346	negative regulation of hepatocyte proliferation	ISS	biological process
GO:2000639	negative regulation of SREBP signaling pathway	ISS	biological process
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:0010629	negative regulation of gene expression	IGI	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881