• Gene id: 55290

Gene Summary

• Gene Symbol: BRF2   Gene   UCSC   Ensembl
• Aliases: BRFU, TFIIIB50
• Gene name: BRF2 RNA polymerase III transcription initiation factor subunit
• Alternate names: transcription factor IIIB 50 kDa subunit, B-related factor 2, BRF-2, BRF2, RNA polymerase III transcription initiation factor 50 kDa subunit, BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like, RNA polymerase III transcription initi,
• Gene location: 8p11.23 (37849860: 37843267)     Exons: 4     NC_000008.11
• Gene summary(Entrez): This gene encodes one of the multiple subunits of the RNA polymerase III transcription factor complex required for transcription of genes with promoter elements upstream of the initiation site. The product of this gene, a TFIIB-like factor, is directly re
• OMIM: 610076

Protein Summary

• Protein general information: Q9HAW0  
  • Name: Transcription factor IIIB 50 kDa subunit (TFIIIB50) (hTFIIIB50) (B related factor 2) (BRF 2) (hBRFU)
  • Length: 419  
  • Mass: 46533
• Sequence:

  MPGRGRCPDCGSTELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRR
  VRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRAARLQKKEVLVGCCVLITCRQHNWPLTMGAICTLLYADLDVFS
  STYMQIVKLLGLDVPSLCLAELVKTYCSSFKLFQASPSVPAKYVEDKEKMLSRTMQLVELANETWLVTGRHPLPV
  ITAATFLAWQSLQPADRLSCSLARFCKLANVDLPYPASSRLQELLAVLLRMAEQLAWLRVLRLDKRSVVKHIGDL
  LQHRQSLVRSAFRDGTAEVETREKEPPGWGQGQGEGEVGNNSLGLPQGKRPASPALLLPPCMLKSPKRICPVPPV
  STVTGDENISDSEIEQYLRTPQEVRDFQRAQAARQAATSVPNPP

• Structural information:
  • Interpro: IPR036915  IPR000812  IPR013137  
  • Prosite: PS51134
  • PDB: 4ROC 4ROD 4ROE 5N9G
  • PDBsum: 4ROC 4ROD 4ROE 5N9G
  • STRING: ENSP00000220659
• Other Databases: GeneCards:  BRF2  Malacards:  BRF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006352	DNA-templated transcription, initiation	IBA	biological process
GO:0001006	RNA polymerase III type 3 promoter sequence-specific DNA binding	IBA	molecular function
GO:0000126	transcription factor TFIIIB complex	IBA	cellular component
GO:0070898	RNA polymerase III preinitiation complex assembly	IBA	biological process
GO:0008134	transcription factor binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0001006	RNA polymerase III type 3 promoter sequence-specific DNA binding	IDA	molecular function
GO:0034599	cellular response to oxidative stress	IMP	biological process
GO:0000126	transcription factor TFIIIB complex	IMP	cellular component
GO:0006359	regulation of transcription by RNA polymerase III	IMP	biological process
GO:0006352	DNA-templated transcription, initiation	IEA	biological process
GO:0070897	transcription preinitiation complex assembly	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006352	DNA-templated transcription, initiation	IBA	biological process
GO:0001006	RNA polymerase III type 3 promoter sequence-specific DNA binding	IBA	molecular function
GO:0000126	transcription factor TFIIIB complex	IBA	cellular component
GO:0070898	RNA polymerase III preinitiation complex assembly	IBA	biological process
GO:0008134	transcription factor binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0001006	RNA polymerase III type 3 promoter sequence-specific DNA binding	IDA	molecular function
GO:0034599	cellular response to oxidative stress	IMP	biological process
GO:0000126	transcription factor TFIIIB complex	IMP	cellular component
GO:0006359	regulation of transcription by RNA polymerase III	IMP	biological process
GO:0006352	DNA-templated transcription, initiation	IEA	biological process
GO:0070897	transcription preinitiation complex assembly	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881