• Gene id: 55284

Gene Summary

• Gene Symbol: UBE2W   Gene   UCSC   Ensembl
• Aliases: UBC-16, UBC16
• Gene name: ubiquitin conjugating enzyme E2 W
• Alternate names: ubiquitin-conjugating enzyme E2 W, E2 ubiquitin-conjugating enzyme W, N-terminal E2 ubiquitin-conjugating enzyme, N-terminus-conjugating E2, ubiquitin carrier protein W, ubiquitin conjugating enzyme E2 W (putative), ubiquitin conjugating enzyme E2W (putative), u,
• Gene location: 8q21.11 (73878861: 73780095)     Exons: 10     NC_000008.11
• Gene summary(Entrez): This gene encodes a nuclear-localized ubiquitin-conjugating enzyme (E2) that, along with ubiquitin-activating (E1) and ligating (E3) enzymes, coordinates the addition of a ubiquitin moiety to existing proteins. The encoded protein promotes the ubiquitinat
• OMIM: 614277

Protein Summary

• Protein general information: Q96B02  
  • Name: Ubiquitin conjugating enzyme E2 W (EC 2.3.2.23) (E2 ubiquitin conjugating enzyme W) (N terminal E2 ubiquitin conjugating enzyme) (EC 2.3.2.25) (N terminus conjugating E2) (Ubiquitin carrier protein W) (Ubiquitin conjugating enzyme 16) (UBC 16) (Ubiquitin
  • Length: 151  
  • Mass: 17331
  • Tissue specificity: Widely expressed, with highest expression in brain, liver, pancreas and heart. {ECO
• Sequence:

  MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTG
  ENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWYHDDT
  C

• Structural information:
  • Interpro: IPR000608  IPR016135  
  • Prosite: PS50127
  • CDD: cd00195
  • PDB: 2A7L 2MT6
  • PDBsum: 2A7L 2MT6
  • DIP: 52724
  • STRING: ENSP00000397453
• Other Databases: GeneCards:  UBE2W  Malacards:  UBE2W

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061631	ubiquitin conjugating enzyme activity	IBA	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0006513	protein monoubiquitination	IDA	biological process
GO:0071218	cellular response to misfolded protein	ISS	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0004842	ubiquitin-protein transferase activity	IMP	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	ISS	biological process
GO:0006515	protein quality control for misfolded or incompletely synthesized proteins	ISS	biological process
GO:0006513	protein monoubiquitination	IMP	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0061631	ubiquitin conjugating enzyme activity	IEA	molecular function
GO:0016567	protein ubiquitination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0006513	protein monoubiquitination	IDA	biological process
GO:0070979	protein K11-linked ubiquitination	IDA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq