• Gene id: 5528

Gene Summary

• Gene Symbol: PPP2R5D   Gene   UCSC   Ensembl
• Aliases: B56D, B56delta, MRD35
• Gene name: protein phosphatase 2 regulatory subunit B'delta
• Alternate names: serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform, PP2A, B subunit, B' delta isoform, PP2A, B subunit, B56 delta isoform, PP2A, B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta isoform, Serine/threonine protein phosphatase,
• Gene location: 6p21.1 (42984569: 43012341)     Exons: 16     NC_000006.12
• Gene summary(Entrez): The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common het
• OMIM: 601646

Protein Summary

• Protein general information: Q14738  
  • Name: Serine/threonine protein phosphatase 2A 56 kDa regulatory subunit delta isoform (PP2A B subunit isoform B' delta) (PP2A B subunit isoform B56 delta) (PP2A B subunit isoform PR61 delta) (PP2A B subunit isoform R5 delta)
  • Length: 602  
  • Mass: 69992
  • Tissue specificity: Isoform Delta-2 is widely expressed. Isoform Delta-1 is highly expressed in brain.
• Sequence:

  MPYKLKKEKEPPKVAKCTAKPSSSGKDGGGENTEEAQPQPQPQPQPQAQSQPPSSNKRPSNSTPPPTQLSKIKYS
  GGPQIVKKERRQSSSRFNLSKNRELQKLPALKDSPTQEREELFIQKLRQCCVLFDFVSDPLSDLKFKEVKRAGLN
  EMVEYITHSRDVVTEAIYPEAVTMFSVNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPD
  FQPNIAKKYIDQKFVLALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIAEL
  LEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESSLTEPVIVGLLKFWPKTHSP
  KEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAARVLPIMFPAL
  YRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAP
  PPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQE
  AL

• Structural information:
  • Interpro: IPR011989  IPR016024  IPR002554  
  • DIP: 29961
  • STRING: ENSP00000417963
• Other Databases: GeneCards:  PPP2R5D  Malacards:  PPP2R5D

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000159	protein phosphatase type 2A complex	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0006470	protein dephosphorylation	IBA	biological process
GO:0031952	regulation of protein autophosphorylation	IBA	biological process
GO:0072542	protein phosphatase activator activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0000159	protein phosphatase type 2A complex	IEA	cellular component
GO:0019888	protein phosphatase regulator activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0019888	protein phosphatase regulator activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0007399	nervous system development	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010801	negative regulation of peptidyl-threonine phosphorylation	IEA	biological process
GO:0035307	positive regulation of protein dephosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0006470	protein dephosphorylation	IDA	biological process
GO:0004721	phosphoprotein phosphatase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04728	Dopaminergic synapse
hsa04114	Oocyte meiosis
hsa04071	Sphingolipid signaling pathway
hsa04152	AMPK signaling pathway
hsa03015	mRNA surveillance pathway

Diseases

Associated diseases	References
Autosomal dominant mental retardation	KEGG:H00773
Autosomal dominant mental retardation	KEGG:H00773
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq