• Gene id: 55278

Gene Summary

• Gene Symbol: QRSL1   Gene   UCSC   Ensembl
• Aliases: COXPD40, GatA
• Gene name: glutaminyl-tRNA amidotransferase subunit QRSL1
• Alternate names: glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial, QRSL1, glutaminyl-tRNA amidotransferase subunit A, glu-AdT subunit A, glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1, glutaminyl-tRNA synthase-like protein 1, glutamyl-tRNA(Gln) amidotransf,
• Gene location: 6q21 (106629577: 106668416)     Exons: 12     NC_000006.12
• OMIM: 616990

Protein Summary

• Protein general information: Q9H0R6  
  • Name: Glutamyl tRNA(Gln) amidotransferase subunit A, mitochondrial (Glu AdT subunit A) (EC 6.3.5.7) (Glutaminyl tRNA synthase like protein 1)
  • Length: 528  
  • Mass: 57460
• Sequence:

  MLGRSLREVSAALKQGQITPTELCQKCLSLIKKTKFLNAYITVSEEVALKQAEESEKRYKNGQSLGDLDGIPIAV
  KDNFSTSGIETTCASNMLKGYIPPYNATVVQKLLDQGALLMGKTNLDEFAMGSGSTDGVFGPVKNPWSYSKQYRE
  KRKQNPHSENEDSDWLITGGSSGGSAAAVSAFTCYAALGSDTGGSTRNPAAHCGLVGFKPSYGLVSRHGLIPLVN
  SMDVPGILTRCVDDAAIVLGALAGPDPRDSTTVHEPINKPFMLPSLADVSKLCIGIPKEYLVPELSSEVQSLWSK
  AADLFESEGAKVIEVSLPHTSYSIVCYHVLCTSEVASNMARFDGLQYGHRCDIDVSTEAMYAATRREGFNDVVRG
  RILSGNFFLLKENYENYFVKAQKVRRLIANDFVNAFNSGVDVLLTPTTLSEAVPYLEFIKEDNRTRSAQDDIFTQ
  AVNMAGLPAVSIPVALSNQGLPIGLQFIGRAFCDQQLLTVAKWFEKQVQFPVIQLQELMDDCSAVLENEKLASVS
  LKQ

• Structural information:
  • Interpro: IPR000120  IPR023631  IPR036928  IPR004412  
  • DIP: 48970
  • STRING: ENSP00000358042
• Other Databases: GeneCards:  QRSL1  Malacards:  QRSL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070681	glutaminyl-tRNAGln biosynthesis via transamidation	IBA	biological process
GO:0032543	mitochondrial translation	IBA	biological process
GO:0050567	glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity	IBA	molecular function
GO:0030956	glutamyl-tRNA(Gln) amidotransferase complex	IBA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0070681	glutaminyl-tRNAGln biosynthesis via transamidation	IDA	biological process
GO:0050567	glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity	IDA	molecular function
GO:0030956	glutamyl-tRNA(Gln) amidotransferase complex	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0032543	mitochondrial translation	IMP	biological process
GO:0006412	translation	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0030956	glutamyl-tRNA(Gln) amidotransferase complex	IEA	cellular component
GO:0050567	glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0016874	ligase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0050567	glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032543	mitochondrial translation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0031647	regulation of protein stability	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0070681	glutaminyl-tRNAGln biosynthesis via transamidation	IEA	biological process
GO:0016884	carbon-nitrogen ligase activity, with glutamine as amido-N-donor	IEA	molecular function
GO:0032543	mitochondrial translation	IEA	biological process
GO:0050567	glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity	IEA	molecular function
GO:0030956	glutamyl-tRNA(Gln) amidotransferase complex	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00970	Aminoacyl-tRNA biosynthesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881