• Gene id: 55273

Gene Summary

• Gene Symbol: TMEM100   Gene   UCSC   Ensembl
• Gene name: transmembrane protein 100
• Alternate names: transmembrane protein 100,
• Gene location: 17q22 (55732080: 55719626)     Exons: 6     NC_000017.11
• OMIM: 616334

Protein Summary

• Protein general information: Q9NV29  
  • Name: Transmembrane protein 100
  • Length: 134  
  • Mass: 14386
  • Tissue specificity: Expressed in neurons of the myenteric and submucosal plexuses in the gastric body, jejunum and proximal colon. Expressed in arterial endothelial cells and neurons of the central nervous system and peripheral nervous system. Expressed i
• Sequence:

  MTEEPIKEILGAPKAHMAATMEKSPKSEVVITTVPLVSEIQLMAATGGTELSCYRCIIPFAVVVFIAGIVVTAVA
  YSFNSHGSIISIFGLVVLSSGLFLLASSALCWKVRQRSKKAKRRESQTALVANQRSLFA

• Structural information:
  • Interpro: IPR032536  
  • STRING: ENSP00000465638
• Other Databases: GeneCards:  TMEM100  Malacards:  TMEM100

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071773	cellular response to BMP stimulus	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0071773	cellular response to BMP stimulus	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0043204	perikaryon	IDA	cellular component
GO:0030509	BMP signaling pathway	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0051930	regulation of sensory perception of pain	ISS	biological process
GO:0045603	positive regulation of endothelial cell differentiation	ISS	biological process
GO:2001214	positive regulation of vasculogenesis	ISS	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060842	arterial endothelial cell differentiation	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0045603	positive regulation of endothelial cell differentiation	IEA	biological process
GO:0043491	protein kinase B signaling	IEA	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0003197	endocardial cushion development	IEA	biological process
GO:0001570	vasculogenesis	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:2001214	positive regulation of vasculogenesis	IEA	biological process
GO:0051930	regulation of sensory perception of pain	IEA	biological process
GO:0050848	regulation of calcium-mediated signaling	IEA	biological process
GO:0043204	perikaryon	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0003198	epithelial to mesenchymal transition involved in endocardial cushion formation	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)