• Gene id: 55272

Gene Summary

• Gene Symbol: IMP3   Gene   UCSC   Ensembl
• Aliases: BRMS2, C15orf12, MRPS4
• Gene name: IMP U3 small nucleolar ribonucleoprotein 3
• Alternate names: U3 small nucleolar ribonucleoprotein protein IMP3, IMP3, U3 small nucleolar ribonucleoprotein, homolog, U3 snoRNP protein 3 homolog, U3 snoRNP protein IMP3,
• Gene location: 15q24.2 (75640322: 75639084)     Exons: 1     NC_000015.10
• Gene summary(Entrez): This gene encodes the human homolog of the yeast Imp3 protein. The protein localizes to the nucleoli and interacts with the U3 snoRNP complex. The protein contains an S4 domain. [provided by RefSeq, Jul 2008]
• OMIM: 612980

Protein Summary

• Protein general information: Q9NV31  
  • Name: U3 small nucleolar ribonucleoprotein protein IMP3 (U3 snoRNP protein IMP3) (BRMS2)
  • Length: 184  
  • Mass: 21850
• Sequence:

  MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRA
  SAALLDKLYALGLVPTRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLV
  TRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA

• Structural information:
  • Protein Domains: (109..17-)
    (/note="S4-RNA-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00182"-)
  • Interpro: IPR022801  IPR001912  IPR002942  IPR036986  
  • Prosite: PS50889
  • CDD: cd00165
  • PDB: 2CQJ
  • PDBsum: 2CQJ
  • STRING: ENSP00000326981
• Other Databases: GeneCards:  IMP3  Malacards:  IMP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005730	nucleolus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0030515	snoRNA binding	IBA	molecular function
GO:0034457	Mpp10 complex	IBA	cellular component
GO:0032040	small-subunit processome	IBA	cellular component
GO:0006364	rRNA processing	IBA	biological process
GO:0019843	rRNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0019843	rRNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006364	rRNA processing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0030684	preribosome	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0034457	Mpp10 complex	IDA	cellular component
GO:0006364	rRNA processing	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006364	rRNA processing	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03008	Ribosome biogenesis in eukaryotes

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881