• Gene id: 5527

Gene Summary

• Gene Symbol: PPP2R5C   Gene   UCSC   Ensembl
• Aliases: B56G, B56gamma, PR61G
• Gene name: protein phosphatase 2 regulatory subunit B'gamma
• Alternate names: serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform, B' alpha regulatory subunit, PP2A B subunit isoform B'-gamma, PP2A B subunit isoform B56-gamma, PP2A B subunit isoform PR61-gamma, PP2A B subunit isoform R5-gamma, protein phosphat,
• Gene location: 14q32.31 (151411343: 151556317)     Exons: 27     NC_000005.10
• Gene summary(Entrez): The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common het
• OMIM: 601645

Protein Summary

• Protein general information: Q13362  
  • Name: Serine/threonine protein phosphatase 2A 56 kDa regulatory subunit gamma isoform (PP2A B subunit isoform B' gamma) (PP2A B subunit isoform B56 gamma) (PP2A B subunit isoform PR61 gamma) (PP2A B subunit isoform R5 gamma) (Renal carcinoma antigen NY REN 29)
  • Length: 524  
  • Mass: 61061
  • Tissue specificity: Highest levels in heart, skeletal muscle and brain. Lower levels in pancreas, kidney, lung and placenta. Very low levels in liver.
• Sequence:

  MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSE
  MVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDF
  QPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELL
  EILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVMALLKYWPKTHSPK
  EVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLY
  RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIENLAKANPQYTVYSQAS
  TMSIPVAMETDGPLFEDVQMLRKTVKDEAHQAQKDPKKDRPLARRKSELPQDPHTKKALEAHCRADELASQDGR

• Structural information:
  • Interpro: IPR011989  IPR016024  IPR002554  
  • PDB: 2IAE 2JAK 2NPP 2NYL 2NYM 3FGA 5JJA 5K6S 5SW9 5SWF
  • PDBsum: 2IAE 2JAK 2NPP 2NYL 2NYM 3FGA 5JJA 5K6S 5SW9 5SWF
  • DIP: 39401
  • STRING: ENSP00000412324
• Other Databases: GeneCards:  PPP2R5C  Malacards:  PPP2R5C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0072542	protein phosphatase activator activity	IBA	molecular function
GO:0031952	regulation of protein autophosphorylation	IBA	biological process
GO:0006470	protein dephosphorylation	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0000159	protein phosphatase type 2A complex	IBA	cellular component
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0000775	chromosome, centromeric region	IDA	cellular component
GO:0000159	protein phosphatase type 2A complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0000159	protein phosphatase type 2A complex	IEA	cellular component
GO:0019888	protein phosphatase regulator activity	IEA	molecular function
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0051898	negative regulation of protein kinase B signaling	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0014066	regulation of phosphatidylinositol 3-kinase signaling	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0007165	signal transduction	NAS	biological process
GO:0019888	protein phosphatase regulator activity	NAS	molecular function
GO:0000159	protein phosphatase type 2A complex	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04728	Dopaminergic synapse
hsa04114	Oocyte meiosis
hsa04071	Sphingolipid signaling pathway
hsa04152	AMPK signaling pathway
hsa03015	mRNA surveillance pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq