• Gene id: 55258

Gene Summary

• Gene Symbol: THNSL2   Gene   UCSC   Ensembl
• Aliases: SOFAT, THS2, TSH2
• Gene name: threonine synthase like 2
• Alternate names: threonine synthase-like 2, secreted osteoclastogenic factor of activated T cells,
• Gene location: 2p11.2 (88170294: 88186636)     Exons: 9     NC_000002.12
• Gene summary(Entrez): This gene encodes a threonine synthase-like protein. A similar enzyme in mouse can catalyze the degradation of O-phospho-homoserine to a-ketobutyrate, phosphate, and ammonia. This protein also has phospho-lyase activity on both gamma and beta phosphorylat
• OMIM: 600168

Protein Summary

• Protein general information: Q86YJ6  
  • Name: Threonine synthase like 2 (TSH2) (EC 4.2.3. ) (Secreted osteoclastogenic factor of activated T cells) (SOFAT)
  • Length: 484  
  • Mass: 54116
• Sequence:

  MWYVSTRGVAPRVNFEGALFSGYAPDGGLFMPEELPQLDRGTLCQWSTLSYPGLVKELCALFIGSELLPKDELND
  LIDRAFSRFRHREVVHLSRLRNGLNVLELWHGVTYAFKDLSLSCTTQFLQYFLEKREKHVTVVVGTSGDTGSAAI
  ESVQGAKNMDIIVLLPKGHCTKIQELQMTTVLKQNVHVFGVEGNSDELDEPIKTVFADVAFVKKHNLMSLNSINW
  SRVLVQMAHHFFAYFQCTPSLDTHPLPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDF
  SLSEAVKSTLASAMDIQVPYNMERVFWLLSGSDSQVTRALMEQFERTQSVNLPKELHSKLSEAVTSVSVSDEAIT
  QTMGRCWDENQYLLCPHSAVAVNYHYQQIDRQQPSTPRCCLAPASAAKFPEAVLAAGLTPETPAEIVALEHKETR
  CTLMRRGDNWMLMLRDTIEDLSRQWRSHALNTSQ

• Structural information:
  • Interpro: IPR001926  IPR029144  IPR037158  IPR004450  IPR036052  
  • STRING: ENSP00000327323
• Other Databases: GeneCards:  THNSL2  Malacards:  THNSL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046360	2-oxobutyrate biosynthetic process	IBA	biological process
GO:0030170	pyridoxal phosphate binding	IBA	molecular function
GO:0016311	dephosphorylation	IBA	biological process
GO:0009071	serine family amino acid catabolic process	IBA	biological process
GO:0004795	threonine synthase activity	IBA	NOT|molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016829	lyase activity	IEA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0016311	dephosphorylation	IEA	biological process
GO:0030170	pyridoxal phosphate binding	IEA	molecular function
GO:0046360	2-oxobutyrate biosynthetic process	IEA	biological process
GO:0009071	serine family amino acid catabolic process	IEA	biological process
GO:0070905	serine binding	IEA	molecular function
GO:0030170	pyridoxal phosphate binding	ISS	molecular function
GO:0070905	serine binding	ISS	molecular function
GO:0016311	dephosphorylation	ISS	biological process
GO:0046360	2-oxobutyrate biosynthetic process	ISS	biological process
GO:0009071	serine family amino acid catabolic process	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0008150	biological_process	ND	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R