• Gene id: 55257

Gene Summary

• Gene Symbol: MRGBP   Gene   UCSC   Ensembl
• Aliases: C20orf20, Eaf7, MRG15BP, URCC4
• Gene name: MRG domain binding protein
• Alternate names: MRG/MORF4L-binding protein, MRG-binding protein, MRG/MORF4L binding protein, up-regulated in colon cancer 4,
• Gene location: 20q13.33 (62796472: 62801728)     Exons: 5     NC_000020.11
• OMIM: 611157

Protein Summary

• Protein general information: Q9NV56  
  • Name: MRG/MORF4L binding protein (MRG binding protein) (Up regulated in colon cancer 4) (Urcc4)
  • Length: 204  
  • Mass: 22417
• Sequence:

  MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVPSK
  VIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHNGADDVFSSSGSL
  GKASEKSSKDKEKNSSDLGCKEGADKRKRSRVTDKVLTANSNPSSPSAAKRRRT

• Structural information:
  • Interpro: IPR012423  
  • PDB: 2N1D
  • PDBsum: 2N1D
  • DIP: 29018
  • STRING: ENSP00000359518
• Other Databases: GeneCards:  MRGBP  Malacards:  MRGBP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016573	histone acetylation	IBA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0035267	NuA4 histone acetyltransferase complex	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0043189	H4/H2A histone acetyltransferase complex	IEA	cellular component
GO:0006325	chromatin organization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0040008	regulation of growth	IEA	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray