• Gene id: 55253

Gene Summary

• Gene Symbol: TYW1   Gene   UCSC   Ensembl
• Aliases: RSAFD1, TYW1A, YPL207W
• Gene name: tRNA-yW synthesizing protein 1 homolog
• Alternate names: S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase TYW1, S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase, radical S-adenosyl methionine and flavodoxin domain-containing protein 1, radical S-adenosyl methionine and flavodoxin ,
• Gene location: 7q11.21 (66996804: 67239514)     Exons: 18     NC_000007.14
• Gene summary(Entrez): Wybutosine (yW) is a hypermodified guanosine found in phenylalanine tRNA adjacent to the anticodon that stabilizes codon-anticodon interactions in the ribosome. In yeast, the homolog of this gene is essential for the synthesis of wybutosine. Alternative s
• OMIM: 615603

Protein Summary

• Protein general information: Q9NV66  
  • Name: S adenosyl L methionine dependent tRNA 4 demethylwyosine synthase TYW1 (EC 4.1.3.44) (Radical S adenosyl methionine and flavodoxin domain containing protein 1) (tRNA wybutosine synthesizing protein 1 homolog) (tRNA yW synthesizing protein)
  • Length: 732  
  • Mass: 83702
• Sequence:

  MDPSADTWDLFSPLISLWINRFYIYLGFAVSISLWICVQIVIKTQGKNLQEKSVPKAAQDLMTNGYVSLQEKDIF
  VSGVKIFYGSQTGTAKGFATVLAEAVTSLDLPVAIINLKEYDPDDHLIEEVTSKNVCVFLVATYTDGLPTESAEW
  FCKWLEEASIDFRFGKTYLKGMRYAVFGLGNSAYASHFNKVGKNVDKWLWMLGAHRVMSRGEGDCDVVKSKHGSI
  EADFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEEREEGSHEQDELHHRDTEEEEPFESSSEEEF
  GGEDHQSLNSIVDVEDLGKIMDHVKKEKREKEQQEEKSGLFRNMGRNEDGERRAMITPALREALTKQGYQLIGSH
  SGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDQPEMILKEAI
  ENHQNMIKQFKGVPGVKAERFEEGMTVKHCALSLVGEPIMYPEINRFLKLLHQCKISSFLVTNAQFPAEIRNLEP
  VTQLYVSVDASTKDSLKKIDRPLFKDFWQRFLDSLKALAVKQQRTVYRLTLVKAWNVDELQAYAQLVSLGNPDFI
  EVKGVTYCGESSASSLTMAHVPWHEEVVQFVHELVDLIPEYEIACEHEHSNCLLIAHRKFKIGGEWWTWIDYNRF
  QELIQEYEDSGGSKTFSAKDYMARTPHWALFGASERGFDPKDTRHQRKNKSKAISGC

• Structural information:
  • Protein Domains: (79..23-)
    (/note="Flavodoxin-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00088"-)
  • Interpro: IPR013785  IPR001094  IPR008254  IPR029039  IPR007197   IPR013917  IPR034556  
  • Prosite: PS50902
  • STRING: ENSP00000352645
• Other Databases: GeneCards:  TYW1  Malacards:  TYW1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031591	wybutosine biosynthetic process	IBA	biological process
GO:0008033	tRNA processing	IEA	biological process
GO:0010181	FMN binding	IEA	molecular function
GO:0051539	4 iron, 4 sulfur cluster binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0008033	tRNA processing	IEA	biological process
GO:0051539	4 iron, 4 sulfur cluster binding	IEA	molecular function
GO:0016829	lyase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0102521	tRNA-4-demethylwyosine synthase activity	IEA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq