• Gene id: 5525

Gene Summary

• Gene Symbol: PPP2R5A   Gene   UCSC   Ensembl
• Aliases: B56A, B56alpha, PR61A
• Gene name: protein phosphatase 2 regulatory subunit B'alpha
• Alternate names: serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform, PP2A B subunit isoform B'-alpha, PP2A B subunit isoform B56-alpha, PP2A B subunit isoform PR61-alpha, PP2A B subunit isoform R5-alpha, PP2A, B subunit, B' alpha isoform, PP2A, B su,
• Gene location: 1q32.3 (150562657: 150673142)     Exons: 19     NC_000023.11
• Gene summary(Entrez): The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common het
• OMIM: 601643

Protein Summary

• Protein general information: Q15172  
  • Name: Serine/threonine protein phosphatase 2A 56 kDa regulatory subunit alpha isoform (PP2A B subunit isoform B' alpha) (PP2A B subunit isoform B56 alpha) (PP2A B subunit isoform PR61 alpha) (PR61alpha) (PP2A B subunit isoform R5 alpha)
  • Length: 486  
  • Mass: 56194
  • Tissue specificity: Widely expressed with the highest expression in heart and skeletal muscle.
• Sequence:

  MSSSSPPAGAASAAISASEKVDGFTRKSVRKAQRQKRSQGSSQFRSQGSQAELHPLPQLKDATSNEQQELFCQKL
  QQCCILFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEP
  TLEASWPHIQLVYEFFLRFLESPDFQPSIAKRYIDQKFVQQLLELFDSEDPRERDFLKTVLHRIYGKFLGLRAFI
  RKQINNIFLRFIYETEHFNGVAELLEILGSIINGFALPLKAEHKQFLMKVLIPMHTAKGLALFHAQLAYCVVQFL
  EKDTTLTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIEEPLFKQISKCVSSSHFQVAERALYFW
  NNEYILSLIEENIDKILPIMFASLYKISKEHWNPTIVALVYNVLKTLMEMNGKLFDDLTSSYKAERQREKKKELE
  REELWKKLEELKLKKALEKQNSAYNMHSILSNTSAE

• Structural information:
  • Interpro: IPR011989  IPR016024  IPR002554  
  • DIP: 459
  • STRING: ENSP00000261461
• Other Databases: GeneCards:  PPP2R5A  Malacards:  PPP2R5A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0072542	protein phosphatase activator activity	IBA	molecular function
GO:0031952	regulation of protein autophosphorylation	IBA	biological process
GO:0006470	protein dephosphorylation	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0000159	protein phosphatase type 2A complex	IBA	cellular component
GO:0000159	protein phosphatase type 2A complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0000159	protein phosphatase type 2A complex	IEA	cellular component
GO:0019888	protein phosphatase regulator activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0019888	protein phosphatase regulator activity	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030018	Z disc	IEA	cellular component
GO:0031430	M band	IEA	cellular component
GO:0019900	kinase binding	IPI	molecular function
GO:1903077	negative regulation of protein localization to plasma membrane	IMP	biological process
GO:0090219	negative regulation of lipid kinase activity	IMP	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0031430	M band	ISS	cellular component
GO:0035307	positive regulation of protein dephosphorylation	IMP	biological process
GO:0030018	Z disc	IDA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0006470	protein dephosphorylation	IDA	biological process
GO:0004721	phosphoprotein phosphatase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04728	Dopaminergic synapse
hsa04114	Oocyte meiosis
hsa04071	Sphingolipid signaling pathway
hsa04152	AMPK signaling pathway
hsa03015	mRNA surveillance pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq