• Gene id: 55249

Gene Summary

• Gene Symbol: YY1AP1   Gene   UCSC   Ensembl
• Aliases: GRNG, HCCA1, HCCA2, YY1AP
• Gene name: YY1 associated protein 1
• Alternate names: YY1-associated protein 1, hepatocellular carcinoma susceptibility protein, hepatocellular carcinoma-associated protein 2,
• Gene location: 1q22 (155689031: 155659441)     Exons: 14     NC_000001.11
• Gene summary(Entrez): The encoded gene product presumably interacts with YY1 protein; however, its exact function is not known. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
• OMIM: 607860

Protein Summary

• Protein general information: Q9H869  
  • Name: YY1 associated protein 1 (Hepatocellular carcinoma susceptibility protein) (Hepatocellular carcinoma associated protein 2)
  • Length: 796  
  • Mass: 87944
  • Tissue specificity: Ubiquitous. Detected in small intestine, skeletal muscle, lung, pancreas, brain, stomach, spleen, colon and heart. Detected at very low levels in healthy liver. Highly expressed in most liver carcinomas. {ECO
• Sequence:

  MEEEASRSAAATNPGSRLTRWPPPDKREGSAVDPGKRRSLAATPSSSLPCTLIALGLRHEKEANELMEDLFETFQ
  DEMGFSNMEDDGPEEEERVAEPQANFNTPQALRFEELLANLLNEQHQIAKELFEQLKMKKPSAKQQKEVEKVKPQ
  CKEVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLATCNPNLNPEASSTRICLKELGTFAQSSIALHHQYNPKFQ
  TLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWILATSKVFMYPELLPVCSLKAKNPQDK
  ILFTKAEDNKYLLTCKTARQLTVRIKNLNMNRAPDNIIKFYKKTKQLPVLGKCCEEIQPHQWKPPIEREEHRLPF
  WLKASLPSIQEELRHMADGAREVGNMTGTTEINSDQGLEKDNSELGSETRYPLLLPKGVVLKLKPVADRFPKKAW
  RQKRSSVLKPLLIQPSPSLQPSFNPGKTPAQSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFES
  PAALPAMPPEARTSFPLSESQTLLSSAPVPKVMMPSPASSMFRKPYVRRRPSKRRGARAFRCIKPAPVIHPASVI
  FTVPATTVKIVSLGGGCNMIQPVNAAVAQSPQTIPIATLLVNPTSFPCPLNQPLVASSVSPLIVSGNSVNLPIPS
  TPEDKAHMNVDIACAVADGENAFQGLEPKLEPQELSPLSATVFPKVEHSPGPPPVDKQCQEGLSENSAYRWTVVK
  TEEGRQALEPLPQGIQESLNNSSPGDLEEVVKMEPEDATEEISGFL

• Structural information:
  • Interpro: IPR033274  
  • STRING: ENSP00000357323
• Other Databases: GeneCards:  YY1AP1  Malacards:  YY1AP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003712	transcription coregulator activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0051726	regulation of cell cycle	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0031011	Ino80 complex	IDA	colocalizes with
GO:0005634	nucleus	IDA	cellular component
GO:0051726	regulation of cell cycle	IMP	biological process
GO:0030154	cell differentiation	IMP	biological process
GO:0008283	cell population proliferation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component

Diseases

Associated diseases	References
Grange syndrome	KEGG:H02224
Grange syndrome	KEGG:H02224
Teratozoospermia	MIK: 17327269
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R