• Gene id: 55247

Gene Summary

• Gene Symbol: NEIL3   Gene   UCSC   Ensembl
• Aliases: FGP2, FPG2, NEI3, ZGRF3, hFPG2, hNEI3
• Gene name: nei like DNA glycosylase 3
• Alternate names: endonuclease 8-like 3, DNA glycosylase FPG2, DNA glycosylase hFPG2, DNA glycosylase/AP lyase Neil3, endonuclease VIII-like 3, nei endonuclease VIII-like 3, nei-like protein 3, zinc finger, GRF-type containing 3,
• Gene location: 4q34.3 (177309870: 177362935)     Exons: 10     NC_000004.12
• Gene summary(Entrez): NEIL3 belongs to a class of DNA glycosylases homologous to the bacterial Fpg/Nei family. These glycosylases initiate the first step in base excision repair by cleaving bases damaged by reactive oxygen species and introducing a DNA strand break via the ass
• OMIM: 610334

Protein Summary

• Protein general information: Q8TAT5  
  • Name: Endonuclease 8 like 3 (EC 3.2.2. ) (EC 4.2.99.18) (DNA glycosylase FPG2) (DNA glycosylase/AP lyase Neil3) (Endonuclease VIII like 3) (Nei like protein 3)
  • Length: 605  
  • Mass: 67769
  • Tissue specificity: Expressed in keratinocytes and embryonic fibroblasts (at protein level). Also detected in thymus, testis and fetal lung primary fibroblasts. {ECO
• Sequence:

  MVEGPGCTLNGEKIRARVLPGQAVTGVRGSALRSLQGRALRLAASTVVVSPQAAALNNDSSQNVLSLFNGYVYSG
  VETLGKELFMYFGPKALRIHFGMKGFIMINPLEYKYKNGASPVLEVQLTKDLICFFDSSVELRNSMESQQRIRMM
  KELDVCSPEFSFLRAESEVKKQKGRMLGDVLMDQNVLPGVGNIIKNEALFDSGLHPAVKVCQLTDEQIHHLMKMI
  RDFSILFYRCRKAGLALSKHYKVYKRPNCGQCHCRITVCRFGDNNRMTYFCPHCQKENPQHVDICKLPTRNTIIS
  WTSSRVDHVMDSVARKSEEHWTCVVCTLINKPSSKACDACLTSRPIDSVLKSEENSTVFSHLMKYPCNTFGKPHT
  EVKINRKTAFGTTTLVLTDFSNKSSTLERKTKQNQILDEEFQNSPPASVCLNDIQHPSKKTTNDITQPSSKVNIS
  PTISSESKLFSPAHKKPKTAQYSSPELKSCNPGYSNSELQINMTDGPRTLNPDSPRCSKHNRLCILRVVGKDGEN
  KGRQFYACPLPREAQCGFFEWADLSFPFCNHGKRSTMKTVLKIGPNNGKNFFVCPLGKEKQCNFFQWAENGPGIK
  IIPGC

• Structural information:
  • Interpro: IPR015886  IPR015887  IPR012319  IPR035937  IPR010979   IPR000214  IPR010666  IPR001876  IPR036443  
  • Prosite: PS51068 PS01242 PS51066 PS01358 PS50199
  • STRING: ENSP00000264596
• Other Databases: GeneCards:  NEIL3  Malacards:  NEIL3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006284	base-excision repair	IBA	biological process
GO:0019104	DNA N-glycosylase activity	IBA	molecular function
GO:0003906	DNA-(apurinic or apyrimidinic site) endonuclease activity	IBA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0006284	base-excision repair	IEA	biological process
GO:0006289	nucleotide-excision repair	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016799	hydrolase activity, hydrolyzing N-glycosyl compounds	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003684	damaged DNA binding	IEA	molecular function
GO:0003906	DNA-(apurinic or apyrimidinic site) endonuclease activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016829	lyase activity	IEA	molecular function
GO:0008152	metabolic process	IEA	biological process
GO:0008152	metabolic process	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0016798	hydrolase activity, acting on glycosyl bonds	IEA	molecular function
GO:0140078	class I DNA-(apurinic or apyrimidinic site) endonuclease activity	IEA	molecular function
GO:0019104	DNA N-glycosylase activity	IDA	molecular function
GO:0006284	base-excision repair	IDA	biological process
GO:0019104	DNA N-glycosylase activity	IEA	molecular function
GO:0006284	base-excision repair	IEA	biological process
GO:0003690	double-stranded DNA binding	IEA	molecular function
GO:0000405	bubble DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003906	DNA-(apurinic or apyrimidinic site) endonuclease activity	IEA	molecular function
GO:0003697	single-stranded DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0003697	single-stranded DNA binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0003906	DNA-(apurinic or apyrimidinic site) endonuclease activity	IDA	molecular function
GO:0019104	DNA N-glycosylase activity	ISS	molecular function
GO:0006284	base-excision repair	ISS	biological process
GO:0003690	double-stranded DNA binding	ISS	molecular function
GO:0000405	bubble DNA binding	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03410	Base excision repair

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881