• Gene id: 55244

Gene Summary

• Gene Symbol: SLC47A1   Gene   UCSC   Ensembl
• Aliases: MATE1
• Gene name: solute carrier family 47 member 1
• Alternate names: multidrug and toxin extrusion protein 1, MATE-1, hMATE-1, multidrug and toxin extrusion 1, solute carrier family 47 (multidrug and toxin extrusion), member 1,
• Gene location: 17p11.2 (85686194: 85683847)     Exons: 1     NC_000011.10
• Gene summary(Entrez): This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function. [provided by RefSeq, Jul 2008]
• OMIM: 609832

Protein Summary

• Protein general information: Q96FL8  
  • Name: Multidrug and toxin extrusion protein 1 (MATE 1) (hMATE 1) (Solute carrier family 47 member 1)
  • Length: 570  
  • Mass: 61922
  • Tissue specificity: Expressed in adrenal gland, and to a lower extent in liver, skeletal muscle and kidney (especially found in luminal membranes of the urinary tubules, bile caniculi and brush border membranes). {ECO
• Sequence:

  MEAPEEPAPVRGGPEATLEVRGSRCLRLSAFREELRALLVLAGPAFLVQLMVFLISFISSVFCGHLGKLELDAVT
  LAIAVINVTGVSVGFGLSSACDTLISQTYGSQNLKHVGVILQRSALVLLLCCFPCWALFLNTQHILLLFRQDPDV
  SRLTQTYVTIFIPALPATFLYMLQVKYLLNQGIVLPQIVTGVAANLVNALANYLFLHQLHLGVIGSALANLISQY
  TLALLLFLYILGKKLHQATWGGWSLECLQDWASFLRLAIPSMLMLCMEWWAYEVGSFLSGILGMVELGAQSIVYE
  LAIIVYMVPAGFSVAASVRVGNALGAGDMEQARKSSTVSLLITVLFAVAFSVLLLSCKDHVGYIFTTDRDIINLV
  AQVVPIYAVSHLFEALACTSGGVLRGSGNQKVGAIVNTIGYYVVGLPIGIALMFATTLGVMGLWSGIIICTVFQA
  VCFLGFIIQLNWKKACQQAQVHANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEE
  PLPEHPQDGAKLSRKQLVLRRGLLLLGVFLILLVGILVRFYVRIQ

• Structural information:
  • Interpro: IPR002528  
  • STRING: ENSP00000270570
• Other Databases: GeneCards:  SLC47A1  Malacards:  SLC47A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042910	xenobiotic transmembrane transporter activity	IBA	molecular function
GO:0022857	transmembrane transporter activity	IBA	molecular function
GO:0015695	organic cation transport	IBA	biological process
GO:0016020	membrane	IBA	cellular component
GO:0015297	antiporter activity	IEA	molecular function
GO:0042910	xenobiotic transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0055085	transmembrane transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006812	cation transport	IEA	biological process
GO:0015695	organic cation transport	IEA	biological process
GO:0042910	xenobiotic transmembrane transporter activity	IEA	molecular function
GO:0098655	cation transmembrane transport	IEA	biological process
GO:0031982	vesicle	IEA	cellular component
GO:0042887	amide transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0042908	xenobiotic transport	IEA	biological process
GO:0042908	xenobiotic transport	IEA	biological process
GO:0042908	xenobiotic transport	IEA	biological process
GO:0042886	amide transport	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray