• Gene id: 55240

Gene Summary

• Gene Symbol: STEAP3   Gene   UCSC   Ensembl
• Aliases: AHMIO2, STMP3, TSAP6, dudlin-2, dudulin-2, pHyde
• Gene name: STEAP3 metalloreductase
• Alternate names: metalloreductase STEAP3, STEAP family member 3, metalloreductase, six-transmembrane epithelial antigen of prostate 3, tumor suppressor pHyde, tumor suppressor-activated pathway protein 6,
• Gene location: 2q14.2 (119222475: 119265651)     Exons: 11     NC_000002.12
• Gene summary(Entrez): This gene encodes a multipass membrane protein that functions as an iron transporter. The encoded protein can reduce both iron (Fe3+) and copper (Cu2+) cations. This protein may mediate downstream responses to p53, including promoting apoptosis. Deficienc

Protein Summary

• Protein general information: Q658P3  
  • Name: Metalloreductase STEAP3 (EC 1.16.1. ) (Dudulin 2) (Six transmembrane epithelial antigen of prostate 3) (Tumor suppressor activated pathway protein 6) (hTSAP6) (pHyde) (hpHyde)
  • Length: 488  
  • Mass: 54601
  • Tissue specificity: Expressed in adult bone marrow, placenta, liver, skeletal muscle and pancreas. Down-regulated in hepatocellular carcinoma. {ECO
• Sequence:

  MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPSAAQVT
  FQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTCTVVKAFNVIS
  AWTLQAGPRDGNRQVPICGDQPEAKRAVSEMALAMGFMPVDMGSLASAWEVEAMPLRLLPAWKVPTLLALGLFVC
  FYAYNFVRDVLQPYVQESQNKFFKLPVSVVNTTLPCVAYVLLSLVYLPGVLAAALQLRRGTKYQRFPDWLDHWLQ
  HRKQIGLLSFFCAALHALYSFCLPLRRAHRYDLVNLAVKQVLANKSHLWVEEEVWRMEIYLSLGVLALGTLSLLA
  VTSLPSIANSLNWREFSFVQSSLGFVALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL
  LPCISRRLARIRRGWERESTIKFTLPTDHALAEKTSHV

• Structural information:
  • Protein Domains: (259..40-)
    (/note="Ferric-oxidoreductase")
  • Interpro: IPR013130  IPR036291  IPR028939  
  • PDB: 2VNS 2VQ3
  • PDBsum: 2VNS 2VQ3
  • STRING: ENSP00000376822
• Other Databases: GeneCards:  STEAP3  Malacards:  STEAP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0008823	cupric reductase activity	IBA	molecular function
GO:0015677	copper ion import	IBA	biological process
GO:0052851	ferric-chelate reductase (NADPH) activity	IBA	molecular function
GO:0005768	endosome	IBA	cellular component
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0009306	protein secretion	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0055072	iron ion homeostasis	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0005771	multivesicular body	IDA	cellular component
GO:0009306	protein secretion	IDA	biological process
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0033572	transferrin transport	TAS	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0010008	endosome membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04115	p53 signaling pathway
hsa04216	Ferroptosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R