• Gene id: 55239

Gene Summary

• Gene Symbol: OGFOD1   Gene   UCSC   Ensembl
• Aliases: TPA1
• Gene name: 2-oxoglutarate and iron dependent oxygenase domain containing 1
• Alternate names: prolyl 3-hydroxylase OGFOD1, 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 1, TPA1, termination and polyadenylation 1, homolog, termination and polyadenylation 1 homolog, uS12 prolyl 3-hydroxylase,
• Gene location: 16q13 (56451523: 56479103)     Exons: 14     NC_000016.10
• OMIM: 604991

Protein Summary

• Protein general information: Q8N543  
  • Name: Prolyl 3 hydroxylase OGFOD1 (EC 1.14.11. ) (2 oxoglutarate and iron dependent oxygenase domain containing protein 1) (Termination and polyadenylation 1 homolog) (uS12 prolyl 3 hydroxylase)
  • Length: 542  
  • Mass: 63246
• Sequence:

  MNGKRPAEPGPARVGKKGKKEVMAEFSDAVTEETLKKQVAEAWSRRTPFSHEVIVMDMDPFLHCVIPNFIQSQDF
  LEGLQKELMNLDFHEKYNDLYKFQQSDDLKKRREPHISTLRKILFEDFRSWLSDISKIDLESTIDMSCAKYEFTD
  ALLCHDDELEGRRIAFILYLVPPWDRSMGGTLDLYSIDEHFQPKQIVKSLIPSWNKLVFFEVSPVSFHQVSEVLS
  EEKSRLSISGWFHGPSLTRPPNYFEPPIPRSPHIPQDHEILYDWINPTYLDMDYQVQIQEEFEESSEILLKEFLK
  PEKFTKVCEALEHGHVEWSSRGPPNKRFYEKAEESKLPEILKECMKLFRSEALFLLLSNFTGLKLHFLAPSEEDE
  MNDKKEAETTDITEEGTSHSPPEPENNQMAISNNSQQSNEQTDPEPEENETKKESSVPMCQGELRHWKTGHYTLI
  HDHSKAEFALDLILYCGCEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLALVYRDRETLKFVKHINHRSLEQKK
  TFPNRTGFWDFSFIYYE

• Structural information:
  • Protein Domains: (134..23-)
    (/note="Fe2OG-dioxygenase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00805"-)
  • Interpro: IPR005123  IPR019601  IPR006620  IPR039558  
  • Prosite: PS51471
  • PDB: 4NHX 4NHY
  • PDBsum: 4NHX 4NHY
  • STRING: ENSP00000457258
• Other Databases: GeneCards:  OGFOD1  Malacards:  OGFOD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019511	peptidyl-proline hydroxylation	IDA	biological process
GO:0006449	regulation of translational termination	IMP	biological process
GO:0031543	peptidyl-proline dioxygenase activity	IBA	molecular function
GO:0019511	peptidyl-proline hydroxylation	IBA	biological process
GO:0006449	regulation of translational termination	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0031544	peptidyl-proline 3-dioxygenase activity	IDA	molecular function
GO:0018126	protein hydroxylation	IDA	biological process
GO:0018126	protein hydroxylation	IDA	biological process
GO:0031543	peptidyl-proline dioxygenase activity	IDA	molecular function
GO:0034063	stress granule assembly	IMP	biological process
GO:0010494	cytoplasmic stress granule	IMP	cellular component
GO:0008283	cell population proliferation	IMP	biological process
GO:0006449	regulation of translational termination	IMP	biological process
GO:0005506	iron ion binding	IEA	molecular function
GO:0016706	2-oxoglutarate-dependent dioxygenase activity	IEA	molecular function
GO:0031418	L-ascorbic acid binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA	molecular function
GO:0031418	L-ascorbic acid binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0051213	dioxygenase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881