Male Infertility Database

Search Result

Gene id

55238

Gene Summary Protein Summary Gene ontology Diseases PubMed

Gene Summary

Gene Symbol

SLC38A7 Gene UCSC Ensembl

Aliases

SNAT7

Gene name

solute carrier family 38 member 7

Alternate names

putative sodium-coupled neutral amino acid transporter 7, amino acid transporter,

Gene location

16q21 (58684769: 58665108) Exons: 13 NC_000016.10

OMIM

614236

Protein Summary

Protein general information

Q9NVC3

Name: Putative sodium coupled neutral amino acid transporter 7 (Solute carrier family 38 member 7)

Length: 462 Mass: 49966

Sequence

MAQVSINNDYSEWDLSTDAGERARLLQSPCVDTAPKSEWEASPGGLDRGTTSTLGAIFIVVNACLGAGLLNFPAA
FSTAGGVAAGIALQMGMLVFIISGLVILAYCSQASNERTYQEVVWAVCGKLTGVLCEVAIAVYTFGTCIAFLIII
GDQQDKIIAVMAKEPEGASGPWYTDRKFTISLTAFLFILPLSIPREIGFQKYASFLSVVGTWYVTAIVIIKYIWP
DKEMTPGNILTRPASWMAVFNAMPTICFGFQCHVSSVPVFNSMQQPEVKTWGGVVTAAMVIALAVYMGTGICGFL
TFGAAVDPDVLLSYPSEDMAVAVARAFIILSVLTSYPILHFCGRAVVEGLWLRYQGVPVEEDVGRERRRRVLQTL
VWFLLTLLLALFIPDIGKVISVIGGLAACFIFVFPGLCLIQAKLSEMEEVKPASWWVLVSYGVLLVTLGAFIFGQ
TTANAIFVDLLA

Structural information

Interpro:	IPR013057
STRING:	ENSP00000454646

Other Databases

GeneCards: SLC38A7 Malacards: SLC38A7

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0005290	L-histidine transmembrane transporter activity	IBA	molecular function
GO:0015186	L-glutamine transmembrane transporter activity	IBA	molecular function
GO:0003333	amino acid transmembrane transport	IBA	biological process
GO:0005313	L-glutamate transmembrane transporter activity	IBA	molecular function
GO:0015171	amino acid transmembrane transporter activity	IBA	molecular function
GO:0015180	L-alanine transmembrane t ransporter activity	IBA	molecular function
GO:0015182	L-asparagine transmembran e transporter activity	IBA	molecular function
GO:0015183	L-aspartate transmembrane transporter activity	IBA	molecular function
GO:0015190	L-leucine transmembrane t ransporter activity	IBA	molecular function
GO:0015191	L-methionine transmembran e transporter activity	IBA	molecular function
GO:0015194	L-serine transmembrane tr ansporter activity	IBA	molecular function
GO:0030424	axon	ISS	cellular component
GO:0015186	L-glutamine transmembrane transporter activity	ISS	molecular function
GO:0015179	L-amino acid transmembran e transporter activity	ISS	molecular function
GO:0006814	sodium ion transport	ISS	biological process
GO:0043025	neuronal cell body	ISS	cellular component
GO:0006865	amino acid transport	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030424	axon	IEA	cellular component
GO:0015186	L-glutamine transmembrane transporter activity	IEA	molecular function
GO:0015179	L-amino acid transmembran e transporter activity	IEA	molecular function
GO:0006814	sodium ion transport	IEA	biological process
GO:0005290	L-histidine transmembrane transporter activity	IEA	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0015194	L-serine transmembrane tr ansporter activity	IEA	molecular function
GO:0015191	L-methionine transmembran e transporter activity	IEA	molecular function
GO:0015190	L-leucine transmembrane t ransporter activity	IEA	molecular function
GO:0015183	L-aspartate transmembrane transporter activity	IEA	molecular function
GO:0015182	L-asparagine transmembran e transporter activity	IEA	molecular function
GO:0015180	L-alanine transmembrane t ransporter activity	IEA	molecular function
GO:0005313	L-glutamate transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:1902475	L-alpha-amino acid transm embrane transport	IEA	biological process
GO:1902475	L-alpha-amino acid transm embrane transport	IEA	biological process
GO:1902475	L-alpha-amino acid transm embrane transport	IEA	biological process
GO:0070778	L-aspartate transmembrane transport	IEA	biological process
GO:0070778	L-aspartate transmembrane transport	IEA	biological process
GO:0015825	L-serine transport	IEA	biological process
GO:0015825	L-serine transport	IEA	biological process
GO:0015821	methionine transport	IEA	biological process
GO:0015821	methionine transport	IEA	biological process
GO:0015813	L-glutamate transmembrane transport	IEA	biological process
GO:0015813	L-glutamate transmembrane transport	IEA	biological process
GO:0006868	glutamine transport	IEA	biological process
GO:0006868	glutamine transport	IEA	biological process
GO:0006868	glutamine transport	IEA	biological process
GO:0098655	cation transmembrane tran sport	IEA	biological process
GO:0098655	cation transmembrane tran sport	IEA	biological process
GO:0089709	L-histidine transmembrane transport	IEA	biological process
GO:0089709	L-histidine transmembrane transport	IEA	biological process
GO:0015808	L-alanine transport	IEA	biological process
GO:0015808	L-alanine transport	IEA	biological process
GO:0015804	neutral amino acid transp ort	IEA	biological process
GO:0015804	neutral amino acid transp ort	IEA	biological process
GO:0015803	branched-chain amino acid transport	IEA	biological process
GO:0015803	branched-chain amino acid transport	IEA	biological process
GO:0006867	asparagine transport	IEA	biological process
GO:0006867	asparagine transport	IEA	biological process

Diseases

Expand All | Collapse All

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
17327269	Teratozoos permia	13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
21674046	Aberrant C pGs in Low Motility Sperm	18	Male infertility	GSE26881	Show abstract
31037746	Spermatoge nic defect s	16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Diseases

Expand All | Collapse All