• Gene id: 55236

Gene Summary

• Gene Symbol: UBA6   Gene   UCSC   Ensembl
• Aliases: E1-L2, MOP-4, UBE1L2
• Gene name: ubiquitin like modifier activating enzyme 6
• Alternate names: ubiquitin-like modifier-activating enzyme 6, UBA6, ubiquitin-activating enzyme E1, monocyte protein 4, ubiquitin-activating enzyme 6, ubiquitin-activating enzyme E1-like 2, ubiquitin-activating enzyme E1-like protein 2,
• Gene location: 4q13.2 (67701154: 67612651)     Exons: 33     NC_000004.12
• Gene summary(Entrez): Modification of proteins with ubiquitin (UBB; MIM 191339) or ubiquitin-like proteins controls many signaling networks and requires a ubiquitin-activating enzyme (E1), a ubiquitin conjugating enzyme (E2), and a ubiquitin protein ligase (E3). UBE1L2 is an E
• OMIM: 122561

Protein Summary

• Protein general information: A0AVT1  
  • Name: Ubiquitin like modifier activating enzyme 6 (Ubiquitin activating enzyme 6) (EC 6.2.1.45) (Monocyte protein 4) (MOP 4) (Ubiquitin activating enzyme E1 like protein 2) (E1 L2)
  • Length: 1052  
  • Mass: 117970
  • Tissue specificity: Widely expressed. Isoform 2 is predominantly expressed in testis with higher expression in adult testis than in fetal testis. {ECO
• Sequence:

  MEGSEPVAAHQGEEASCSSWGTGSTNKNLPIMSTASVEIDDALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLE
  IAKNLVLAGIKAVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSSVPFNETTDLSF
  LDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDFGDEFEVLDTTGEEPKEIFISNITQAN
  PGIVTCLENHPHKLETGQFLTFREINGMTGLNGSIQQITVISPFSFSIGDTTELEPYLHGGIAVQVKTPKTVFFE
  SLERQLKHPKCLIVDFSNPEAPLEIHTAMLALDQFQEKYSRKPNVGCQQDSEELLKLATSISETLEEKPDVNADI
  VHWLSWTAQGFLSPLAAAVGGVASQEVLKAVTGKFSPLCQWLYLEAADIVESLGKPECEEFLPRGDRYDALRACI
  GDTLCQKLQNLNIFLVGCGAIGCEMLKNFALLGVGTSKEKGMITVTDPDLIEKSNLNRQFLFRPHHIQKPKSYTA
  ADATLKINSQIKIDAHLNKVCPTTETIYNDEFYTKQDVIITALDNVEARRYVDSRCLANLRPLLDSGTMGTKGHT
  EVIVPHLTESYNSHRDPPEEEIPFCTLKSFPAAIEHTIQWARDKFESSFSHKPSLFNKFWQTYSSAEEVLQKIQS
  GHSLEGCFQVIKLLSRRPRNWSQCVELARLKFEKYFNHKALQLLHCFPLDIRLKDGSLFWQSPKRPPSPIKFDLN
  EPLHLSFLQNAAKLYATVYCIPFAEEDLSADALLNILSEVKIQEFKPSNKVVQTDETARKPDHVPISSEDERNAI
  FQLEKAILSNEATKSDLQMAVLSFEKDDDHNGHIDFITAASNLRAKMYSIEPADRFKTKRIAGKIIPAIATTTAT
  VSGLVALEMIKVTGGYPFEAYKNCFLNLAIPIVVFTETTEVRKTKIRNGISFTIWDRWTVHGKEDFTLLDFINAV
  KEKYGIEPTMVVQGVKMLYVPVMPGHAKRLKLTMHKLVKPTTEKKYVDLTVSFAPDIDGDEDLPGPPVRYYFSHD
  TD

• Structural information:
  • Interpro: IPR032420  IPR032418  IPR042302  IPR000594  IPR018965   IPR042449  IPR038252  IPR019572  IPR042063  IPR035985  IPR018075  IPR000011  
  • DIP: 57633
  • STRING: ENSP00000313454
• Other Databases: GeneCards:  UBA6  Malacards:  UBA6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032446	protein modification by small protein conjugation	IBA	biological process
GO:0032446	protein modification by small protein conjugation	IBA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0004839	ubiquitin activating enzyme activity	IBA	molecular function
GO:0016567	protein ubiquitination	IBA	biological process
GO:0006974	cellular response to DNA damage stimulus	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0019780	FAT10 activating enzyme activity	IMP	molecular function
GO:0016567	protein ubiquitination	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006464	cellular protein modification process	IEA	biological process
GO:0008641	ubiquitin-like modifier activating enzyme activity	IEA	molecular function
GO:0016874	ligase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004839	ubiquitin activating enzyme activity	IEA	molecular function
GO:0016567	protein ubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0021764	amygdala development	IEA	biological process
GO:0019780	FAT10 activating enzyme activity	IEA	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0007612	learning	IEA	biological process
GO:0060996	dendritic spine development	IEA	biological process
GO:0021766	hippocampus development	IEA	biological process
GO:0007626	locomotory behavior	IEA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0004839	ubiquitin activating enzyme activity	IEA	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0032446	protein modification by small protein conjugation	IBA	biological process
GO:0032446	protein modification by small protein conjugation	IBA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0004839	ubiquitin activating enzyme activity	IBA	molecular function
GO:0016567	protein ubiquitination	IBA	biological process
GO:0006974	cellular response to DNA damage stimulus	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0019780	FAT10 activating enzyme activity	IMP	molecular function
GO:0016567	protein ubiquitination	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006464	cellular protein modification process	IEA	biological process
GO:0008641	ubiquitin-like modifier activating enzyme activity	IEA	molecular function
GO:0016874	ligase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004839	ubiquitin activating enzyme activity	IEA	molecular function
GO:0016567	protein ubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0021764	amygdala development	IEA	biological process
GO:0019780	FAT10 activating enzyme activity	IEA	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0007612	learning	IEA	biological process
GO:0060996	dendritic spine development	IEA	biological process
GO:0021766	hippocampus development	IEA	biological process
GO:0007626	locomotory behavior	IEA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0004839	ubiquitin activating enzyme activity	IEA	molecular function
GO:0016567	protein ubiquitination	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881