• Gene id: 55226

Gene Summary

• Gene Symbol: NAT10   Gene   UCSC   Ensembl
• Aliases: ALP, Kre33, NET43
• Gene name: N-acetyltransferase 10
• Alternate names: RNA cytidine acetyltransferase, 18S rRNA cytosine acetyltransferase, N-acetyltransferase 10 (GCN5-related), N-acetyltransferase-like protein,
• Gene location: 11p13 (34105628: 34146907)     Exons: 29     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is an RNA cytidine acetyltransferase involved in histone acetylation, tRNA acetylation, the biosynthesis of 18S rRNA, and the enhancement of nuclear architecture and chromatin organization. [provided by RefSeq, Oct 2016]
• OMIM: 611243

Protein Summary

• Protein general information: Q9H0A0  
  • Name: RNA cytidine acetyltransferase (EC 2.3.1. ) (18S rRNA cytosine acetyltransferase) (N acetyltransferase 10) (N acetyltransferase like protein) (hALP)
  • Length: 1025  
  • Mass: 115730
• Sequence:

  MHRKKVDNRIRILIENGVAERQRSLFVVVGDRGKDQVVILHHMLSKATVKARPSVLWCYKKELGFSSHRKKRMRQ
  LQKKIKNGTLNIKQDDPFELFIAATNIRYCYYNETHKILGNTFGMCVLQDFEALTPNLLARTVETVEGGGLVVIL
  LRTMNSLKQLYTVTMDVHSRYRTEAHQDVVGRFNERFILSLASCKKCLVIDDQLNILPISSHVATMEALPPQTPD
  ESLGPSDLELRELKESLQDTQPVGVLVDCCKTLDQAKAVLKFIEGISEKTLRSTVALTAARGRGKSAALGLAIAG
  AVAFGYSNIFVTSPSPDNLHTLFEFVFKGFDALQYQEHLDYEIIQSLNPEFNKAVIRVNVFREHRQTIQYIHPAD
  AVKLGQAELVVIDEAAAIPLPLVKSLLGPYLVFMASTINGYEGTGRSLSLKLIQQLRQQSAQSQVSTTAENKTTT
  TARLASARTLYEVSLQESIRYAPGDAVEKWLNDLLCLDCLNITRIVSGCPLPEACELYYVNRDTLFCYHKASEVF
  LQRLMALYVASHYKNSPNDLQMLSDAPAHHLFCLLPPVPPTQNALPEVLAVIQVCLEGEISRQSILNSLSRGKKA
  SGDLIPWTVSEQFQDPDFGGLSGGRVVRIAVHPDYQGMGYGSRALQLLQMYYEGRFPCLEEKVLETPQEIHTVSS
  EAVSLLEEVITPRKDLPPLLLKLNERPAERLDYLGVSYGLTPRLLKFWKRAGFVPVYLRQTPNDLTGEHSCIMLK
  TLTDEDEADQGGWLAAFWKDFRRRFLALLSYQFSTFSPSLALNIIQNRNMGKPAQPALSREELEALFLPYDLKRL
  EMYSRNMVDYHLIMDMIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIELPSGQLMGLFNRIIR
  KVVKLFNEVQEKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSMDLSEYIIRGDDEEWNEV
  LNKAGPNASIISLKSDKKRKLEAKQEPKQSKKLKNRETKNKKDMKLKRKK

• Structural information:
  • Protein Domains: (558..75-)
    (/note="N-acetyltransferase-)
    (/evidence="ECO:0000255|HAMAP-Rule:MF_03211"-)
  • Interpro: IPR016181  IPR000182  IPR007807  IPR033688  IPR032672   IPR013562  IPR027992  
  • Prosite: PS51186
  • STRING: ENSP00000257829
• Other Databases: GeneCards:  NAT10  Malacards:  NAT10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1904812	rRNA acetylation involved in maturation of SSU-rRNA	IBA	biological process
GO:0005730	nucleolus	IBA	cellular component
GO:0000049	tRNA binding	IBA	molecular function
GO:1990883	rRNA cytidine N-acetyltransferase activity	IBA	molecular function
GO:0045727	positive regulation of translation	IDA	biological process
GO:0106162	mRNA N-acetyltransferase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008080	N-acetyltransferase activity	IEA	molecular function
GO:0016072	rRNA metabolic process	IEA	biological process
GO:0034470	ncRNA processing	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0008033	tRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0006364	rRNA processing	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0008080	N-acetyltransferase activity	EXP	molecular function
GO:0008080	N-acetyltransferase activity	EXP	molecular function
GO:0000154	rRNA modification	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070182	DNA polymerase binding	IPI	molecular function
GO:0005697	telomerase holoenzyme complex	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0000784	nuclear chromosome, telomeric region	HDA	cellular component
GO:0032211	negative regulation of telomere maintenance via telomerase	IMP	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0008080	N-acetyltransferase activity	IEA	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0000154	rRNA modification	IEA	biological process
GO:0042274	ribosomal small subunit biogenesis	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0051391	tRNA acetylation	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0005634	nucleus	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03008	Ribosome biogenesis in eukaryotes

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray