About Us

Search Result


Gene id 5522
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol PPP2R2C   Gene   UCSC   Ensembl
Aliases B55-GAMMA, B55gamma, IMYPNO, IMYPNO1, PR52, PR55G
Gene name protein phosphatase 2 regulatory subunit Bgamma
Alternate names protein phosphatase 2, regulatory subunit B, gamma, PP2A, subunit B, B-gamma isoform, PP2A, subunit B, B55-gamma isoform, PP2A, subunit B, PR55-gamma isoform, PP2A, subunit B, R2-gamma isoform, gamma isoform of regulatory subunit B55, protein phosphatase 2, pho,
Gene location 4p16.1 (75391069: 75432687)     Exons: 8     NC_000012.12
Gene summary(Entrez) The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heter
OMIM 605997

Protein Summary

Protein general information Q9Y2T4  

Name: Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform (IMYPNO1) (PP2A subunit B isoform B55 gamma) (PP2A subunit B isoform PR55 gamma) (PP2A subunit B isoform R2 gamma) (PP2A subunit B isoform gamma)

Length: 447  Mass: 51515

Sequence MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVYSTFQS
HEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKITERDKRPEGYNLKDEEGKLKDLSTVTSLQV
PVLKPMDLMVEVSPRRIFANGHTYHINSISVNSDCETYMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVI
TASEFHPHHCNLFVYSSSKGSLRLCDMRAAALCDKHSKLFEEPEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRD
YLTVKVWDLNMEARPIETYQVHDYLRSKLCSLYENDCIFDKFECAWNGSDSVIMTGAYNNFFRMFDRNTKRDVTL
EASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILHTAWHPAENIIAIAATNNLYIFQDKVNSDMH
Structural information
Interpro:  IPR000009  IPR018067  IPR015943  IPR001680  IPR036322  
Prosite:   PS01024 PS01025
MINT:  
STRING:   ENSP00000335083
Other Databases GeneCards:  PPP2R2C  Malacards:  PPP2R2C

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0043666 regulation of phosphoprot
ein phosphatase activity
IEA biological process
GO:0043666 regulation of phosphoprot
ein phosphatase activity
IEA biological process
GO:0043666 regulation of phosphoprot
ein phosphatase activity
IEA biological process
GO:0019888 protein phosphatase regul
ator activity
NAS molecular function
GO:0000159 protein phosphatase type
2A complex
NAS cellular component
GO:0070262 peptidyl-serine dephospho
rylation
IBA biological process
GO:0005829 cytosol
IBA cellular component
GO:0019888 protein phosphatase regul
ator activity
IBA molecular function
GO:0000159 protein phosphatase type
2A complex
IBA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0000159 protein phosphatase type
2A complex
IEA cellular component
GO:0019888 protein phosphatase regul
ator activity
IEA molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04151PI3K-Akt signaling pathway
hsa05165Human papillomavirus infection
hsa04530Tight junction
hsa04390Hippo signaling pathway
hsa04261Adrenergic signaling in cardiomyocytes
hsa04728Dopaminergic synapse
hsa05160Hepatitis C
hsa04071Sphingolipid signaling pathway
hsa04152AMPK signaling pathway
hsa03015mRNA surveillance pathway
hsa05142Chagas disease
Associated diseases References
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269
Unexplained infertility MIK: 25753583

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
31037746 Spermatoge
nic defect
s

28 men with az
oospermia
Male infertility Microarray
Show abstract
25753583 Unexplaine
d infertil
ity

46 (17 fertile
men, 29 male pa
tients)
Male infertility Microarray
Show abstract