Search Result
Gene id | 5522 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Symbol | PPP2R2C Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Aliases | B55-GAMMA, B55gamma, IMYPNO, IMYPNO1, PR52, PR55G | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene name | protein phosphatase 2 regulatory subunit Bgamma | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Alternate names | protein phosphatase 2, regulatory subunit B, gamma, PP2A, subunit B, B-gamma isoform, PP2A, subunit B, B55-gamma isoform, PP2A, subunit B, PR55-gamma isoform, PP2A, subunit B, R2-gamma isoform, gamma isoform of regulatory subunit B55, protein phosphatase 2, pho, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene location |
4p16.1 (75391069: 75432687) Exons: 8 NC_000012.12 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene summary(Entrez) |
The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heter |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
OMIM | 605997 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein general information | Q9Y2T4 Name: Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform (IMYPNO1) (PP2A subunit B isoform B55 gamma) (PP2A subunit B isoform PR55 gamma) (PP2A subunit B isoform R2 gamma) (PP2A subunit B isoform gamma) Length: 447 Mass: 51515 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequence |
MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVYSTFQS HEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKITERDKRPEGYNLKDEEGKLKDLSTVTSLQV PVLKPMDLMVEVSPRRIFANGHTYHINSISVNSDCETYMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVI TASEFHPHHCNLFVYSSSKGSLRLCDMRAAALCDKHSKLFEEPEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRD YLTVKVWDLNMEARPIETYQVHDYLRSKLCSLYENDCIFDKFECAWNGSDSVIMTGAYNNFFRMFDRNTKRDVTL EASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILHTAWHPAENIIAIAATNNLYIFQDKVNSDMH | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Databases | GeneCards: PPP2R2C  Malacards: PPP2R2C | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
KEGG pathways
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|