• Gene id: 5521

Gene Summary

• Gene Symbol: PPP2R2B   Gene   UCSC   Ensembl
• Aliases: B55BETA, PP2AB55BETA, PP2ABBETA, PP2APR55B, PP2APR55BETA, PR2AB55BETA, PR2ABBETA, PR2APR55BETA, PR52B, PR55-BETA, PR55BETA, SCA12
• Gene name: protein phosphatase 2 regulatory subunit Bbeta
• Alternate names: serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform, PP2A subunit B isoform B55-beta, PP2A subunit B isoform PR55-beta, PP2A subunit B isoform R2-beta, PP2A, subunit B, B-beta isoform, protein phosphatase 2 (formerly 2A), regulator,
• Gene location: 5q32 (147081519: 146580741)     Exons: 14     NC_000005.10
• Gene summary(Entrez): The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heter
• OMIM: 604325

Protein Summary

• Protein general information: Q00005  
  • Name: Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PP2A subunit B isoform B55 beta) (PP2A subunit B isoform PR55 beta) (PP2A subunit B isoform R2 beta) (PP2A subunit B isoform beta)
  • Length: 443  
  • Mass: 51710
  • Tissue specificity: Brain.
• Sequence:

  MEEDIDTRKINNSFLRDHSYATEADIISTVEFNHTGELLATGDKGGRVVIFQREQESKNQVHRRGEYNVYSTFQS
  HEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKLWKVSERDKRPEGYNLKDEEGRLRDPATITTLRV
  PVLRPMDLMVEATPRRVFANAHTYHINSISVNSDYETYMSADDLRINLWNFEITNQSFNIVDIKPANMEELTEVI
  TAAEFHPHHCNTFVYSSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSEIISSISDVKFSHSGRYIMTRD
  YLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGSYNNFFRMFDRNTKRDVTL
  EASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAWHPSENIIAVAATNNLYIFQDKVN

• Structural information:
  • Interpro: IPR000009  IPR018067  IPR015943  IPR001680  IPR019775   IPR036322  
  • Prosite: PS01024 PS01025 PS00678
  • STRING: ENSP00000377936
• Other Databases: GeneCards:  PPP2R2B  Malacards:  PPP2R2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000159	protein phosphatase type 2A complex	IBA	cellular component
GO:0019888	protein phosphatase regulator activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0070262	peptidyl-serine dephosphorylation	IBA	biological process
GO:0005741	mitochondrial outer membrane	ISS	cellular component
GO:0005739	mitochondrion	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000159	protein phosphatase type 2A complex	IEA	cellular component
GO:0019888	protein phosphatase regulator activity	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0019888	protein phosphatase regulator activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04530	Tight junction
hsa04390	Hippo signaling pathway
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04728	Dopaminergic synapse
hsa05160	Hepatitis C
hsa04071	Sphingolipid signaling pathway
hsa04152	AMPK signaling pathway
hsa03015	mRNA surveillance pathway
hsa05142	Chagas disease

Diseases

Associated diseases	References
Spinocerebellar ataxia	KEGG:H00063
Spinocerebellar ataxia	KEGG:H00063
Alzheimer's disease	PMID:21029765
Breast cancer	PMID:20669227
Systemic lupus erythematosus	PMID:21746932
Brain disease	PMID:21471219
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R