• Gene id: 55204

Gene Summary

• Gene Symbol: GOLPH3L   Gene   UCSC   Ensembl
• Aliases: GPP34R
• Gene name: golgi phosphoprotein 3 like
• Alternate names: Golgi phosphoprotein 3-like, GPP34-related protein,
• Gene location: 1q21.3 (150697153: 150646229)     Exons: 6     NC_000001.11
• Gene summary(Entrez): The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is localized at the Golgi stack and may have a regulatory role in Golgi trafficking. [provided by RefS
• OMIM: 612208

Protein Summary

• Protein general information: Q9H4A5  
  • Name: Golgi phosphoprotein 3 like (GPP34 related protein)
  • Length: 285  
  • Mass: 32767
• Sequence:

  MTTLTHRARRTEISKNSEKKMESEEDSNWEKSPDNEDSGDSKDIRLTLMEEVLLLGLKDKEGYTSFWNDCISSGL
  RGGILIELAMRGRIYLEPPTMRKKRLLDRKVLLKSDSPTGDVLLDETLKHIKATEPTETVQTWIELLTGETWNPF
  KLQYQLRNVRERIAKNLVEKGILTTEKQNFLLFDMTTHPVTNTTEKQRLVKKLQDSVLERWVNDPQRMDKRTLAL
  LVLAHSSDVLENVFSSLTDDKYDVAMNRAKDLVELDPEVEGTKPSATEMIWAVLAAFNKS

• Structural information:
  • Interpro: IPR008628  IPR038261  
  • STRING: ENSP00000271732
• Other Databases: GeneCards:  GOLPH3L  Malacards:  GOLPH3L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IBA	biological process
GO:0007030	Golgi organization	IBA	biological process
GO:0031985	Golgi cisterna	IBA	cellular component
GO:0043001	Golgi to plasma membrane protein transport	IBA	biological process
GO:0005802	trans-Golgi network	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0048194	Golgi vesicle budding	IBA	biological process
GO:0070273	phosphatidylinositol-4-phosphate binding	IBA	molecular function
GO:0070273	phosphatidylinositol-4-phosphate binding	IDA	molecular function
GO:0032588	trans-Golgi network membrane	IC	cellular component
GO:0000139	Golgi membrane	IC	cellular component
GO:0050714	positive regulation of protein secretion	IMP	biological process
GO:0007030	Golgi organization	IMP	biological process
GO:0070273	phosphatidylinositol-4-phosphate binding	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0032580	Golgi cisterna membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881