• Gene id: 55201

Gene Summary

• Gene Symbol: MAP1S   Gene   UCSC   Ensembl
• Aliases: BPY2IP1, C19orf5, MAP8, VCY2IP-1, VCY2IP1
• Gene name: microtubule associated protein 1S
• Alternate names: microtubule-associated protein 1S, BPY2-interacting protein 1, MAP-1S, VCY2-interacting protein 1, microtubule-associated protein 8, variable charge Y chromosome 2-interacting protein 1,
• Gene location: 19p13.11 (17719479: 17734514)     Exons: 8     NC_000019.10
• OMIM: 607573

Protein Summary

• Protein general information: Q66K74  
  • Name: Microtubule associated protein 1S (MAP 1S) (BPY2 interacting protein 1) (Microtubule associated protein 8) (Variable charge Y chromosome 2 interacting protein 1) (VCY2 interacting protein 1) (VCY2IP 1) [Cleaved into: MAP1S heavy chain; MAP1S light chain]
  • Length: 1059  
  • Mass: 112211
  • Tissue specificity: Expressed in neurons (at protein level). Expressed in spermatocytes, spermatids and spermatozoa. Expressed in the cerebral cortex. Highly expressed in testis. Moderately expressed in the brain, colon, heart, kidney, liver, lung, placen
• Sequence:

  MAAVAGSGAAAAPSSLLLVVGSEFGSPGLLTYVLEELERGIRSWDVDPGVCNLDEQLKVFVSRHSATFSSIVKGQ
  RSLHHRGDNLETLVLLNPSDKSLYDELRNLLLDPASHKLLVLAGPCLEETGELLLQTGGFSPHHFLQVLKDREIR
  DILATTPPPVQPPILTITCPTFGDWAQLAPAVPGLQGALRLQLRLNPPAQLPNSEGLCEFLEYVAESLEPPSPFE
  LLEPPTSGGFLRLGRPCCYIFPGGLGDAAFFAVNGFTVLVNGGSNPKSSFWKLVRHLDRVDAVLVTHPGADSLPG
  LNSLLRRKLAERSEVAAGGGSWDDRLRRLISPNLGVVFFNACEAASRLARGEDEAELALSLLAQLGITPLPLSRG
  PVPAKPTVLFEKMGVGRLDMYVLHPPSAGAERTLASVCALLVWHPAGPGEKVVRVLFPGCTPPACLLDGLVRLQH
  LRFLREPVVTPQDLEGPGRAESKESVGSRDSSKREGLLATHPRPGQERPGVARKEPARAEAPRKTEKEAKTPREL
  KKDPKPSVSRTQPREVRRAASSVPNLKKTNAQAAPKPRKAPSTSHSGFPPVANGPRSPPSLRCGEASPPSAACGS
  PASQLVATPSLELGPIPAGEEKALELPLAASSIPRPRTPSPESHRSPAEGSERLSLSPLRGGEAGPDASPTVTTP
  TVTTPSLPAEVGSPHSTEVDESLSVSFEQVLPPSAPTSEAGLSLPLRGPRARRSASPHDVDLCLVSPCEFEHRKA
  VPMAPAPASPGSSNDSSARSQERAGGLGAEETPPTSVSESLPTLSDSDPVPLAPGAADSDEDTEGFGVPRHDPLP
  DPLKVPPPLPDPSSICMVDPEMLPPKTARQTENVSRTRKPLARPNSRAAAPKATPVAAAKTKGLAGGDRASRPLS
  ARSEPSEKGGRAPLSRKSSTPKTATRGPSGSASSRPGVSATPPKSPVYLDLAYLPSGSSAHLVDEEFFQRVRALC
  YVISGQDQRKEEGMRAVLDALLASKQHWDRDLQVTLIPTFDSVAMHTWYAETHARHQALGITVLGSNSMVSMQDD
  AFPACKVEF

• Structural information:
  • Interpro: IPR026074  IPR027322  
  • STRING: ENSP00000325313
• Other Databases: GeneCards:  MAP1S  Malacards:  MAP1S

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008017	microtubule binding	IDA	molecular function
GO:0004536	deoxyribonuclease activity	IDA	NOT|molecular function
GO:0015631	tubulin binding	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0008017	microtubule binding	TAS	molecular function
GO:0051015	actin filament binding	IDA	molecular function
GO:0051015	actin filament binding	IDA	NOT|molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0048487	beta-tubulin binding	IDA	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030425	dendrite	ISS	cellular component
GO:0005874	microtubule	IDA	cellular component
GO:0043025	neuronal cell body	ISS	cellular component
GO:0007399	nervous system development	ISS	biological process
GO:0007420	brain development	ISS	biological process
GO:0047497	mitochondrion transport along microtubule	TAS	biological process
GO:0001578	microtubule bundle formation	IMP	biological process
GO:0048812	neuron projection morphogenesis	IEP	biological process
GO:0003779	actin binding	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0008017	microtubule binding	IBA	molecular function
GO:0015631	tubulin binding	IBA	molecular function
GO:0016358	dendrite development	IBA	biological process
GO:0030425	dendrite	IBA	cellular component
GO:0042995	cell projection	IBA	cellular component
GO:0000226	microtubule cytoskeleton organization	IBA	biological process
GO:0005874	microtubule	IBA	cellular component
GO:0005875	microtubule associated complex	IBA	cellular component
GO:0007409	axonogenesis	IBA	biological process
GO:0031114	regulation of microtubule depolymerization	IBA	biological process
GO:0043025	neuronal cell body	IBA	cellular component
GO:0045202	synapse	IBA	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:0000226	microtubule cytoskeleton organization	IEA	biological process
GO:0005874	microtubule	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005874	microtubule	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0015631	tubulin binding	IEA	molecular function
GO:0015630	microtubule cytoskeleton	IEA	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0007420	brain development	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0000226	microtubule cytoskeleton organization	IEA	biological process
GO:0010848	regulation of chromatin disassembly	IDA	biological process
GO:0006914	autophagy	TAS	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006259	DNA metabolic process	IEA	biological process
GO:0045202	synapse	IDA	cellular component
GO:0005874	microtubule	IDA	cellular component
GO:0042995	cell projection	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq